KEGG   Ovis aries (sheep): 780479
Entry
780479            CDS       T03117                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04072  Phospholipase D signaling pathway
oas04144  Endocytosis
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04520  Adherens junction
oas04540  Gap junction
oas04630  JAK-STAT signaling pathway
oas04810  Regulation of actin cytoskeleton
oas04912  GnRH signaling pathway
oas04915  Estrogen signaling pathway
oas04921  Oxytocin signaling pathway
oas04926  Relaxin signaling pathway
oas04928  Parathyroid hormone synthesis, secretion and action
oas04934  Cushing syndrome
oas05160  Hepatitis C
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05171  Coronavirus disease - COVID-19
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    780479 (EGFR)
   04012 ErbB signaling pathway
    780479 (EGFR)
   04014 Ras signaling pathway
    780479 (EGFR)
   04015 Rap1 signaling pathway
    780479 (EGFR)
   04630 JAK-STAT signaling pathway
    780479 (EGFR)
   04066 HIF-1 signaling pathway
    780479 (EGFR)
   04068 FoxO signaling pathway
    780479 (EGFR)
   04020 Calcium signaling pathway
    780479 (EGFR)
   04072 Phospholipase D signaling pathway
    780479 (EGFR)
   04151 PI3K-Akt signaling pathway
    780479 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    780479 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    780479 (EGFR)
   04520 Adherens junction
    780479 (EGFR)
   04540 Gap junction
    780479 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    780479 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    780479 (EGFR)
   04915 Estrogen signaling pathway
    780479 (EGFR)
   04921 Oxytocin signaling pathway
    780479 (EGFR)
   04926 Relaxin signaling pathway
    780479 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    780479 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    780479 (EGFR)
   05206 MicroRNAs in cancer
    780479 (EGFR)
   05205 Proteoglycans in cancer
    780479 (EGFR)
   05230 Central carbon metabolism in cancer
    780479 (EGFR)
   05231 Choline metabolism in cancer
    780479 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    780479 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    780479 (EGFR)
   05212 Pancreatic cancer
    780479 (EGFR)
   05225 Hepatocellular carcinoma
    780479 (EGFR)
   05226 Gastric cancer
    780479 (EGFR)
   05214 Glioma
    780479 (EGFR)
   05218 Melanoma
    780479 (EGFR)
   05219 Bladder cancer
    780479 (EGFR)
   05215 Prostate cancer
    780479 (EGFR)
   05213 Endometrial cancer
    780479 (EGFR)
   05224 Breast cancer
    780479 (EGFR)
   05223 Non-small cell lung cancer
    780479 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    780479 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    780479 (EGFR)
   05171 Coronavirus disease - COVID-19
    780479 (EGFR)
   05163 Human cytomegalovirus infection
    780479 (EGFR)
   05165 Human papillomavirus infection
    780479 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    780479 (EGFR)
   01522 Endocrine resistance
    780479 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    780479 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    780479 (EGFR)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     780479 (EGFR)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   780479 (EGFR)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   780479 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   780479 (EGFR)
  Exosomal proteins of bladder cancer cells
   780479 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Borrelia_P83 APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 780479
NCBI-ProteinID: XP_014957685
Ensembl: ENSOARG00000013753
UniProt: A0A6P3YMT1
LinkDB
Position
19
AA seq 1208 aa
MRLSRAGRAALLVLLAAHFPASLALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQSGYNLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLYENTHALA
VLSNYGANKTGLRELPLRNLQEILQGAVRFSNNPVLCNMETIQWRDIINTDFLSNVTGDF
QNQQGNCSKCDPGCLNRSCWGAGEENCQKLTKIICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRRFRDEATCKDTCPPLMLYDPTTYEMKVNPLGKYSFGATCVKKCPRNYV
VTDHGSCVRACSSDSQEVEEDGVRKCKKCDGPCAKVCNGIGIGEFKDTLSINATNIKHFR
NCTSISGDLHILPVAFRGDSFTRTAPLDPKELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNRNLCYANTIHWKKL
FGTSTQKTKILNNRSDKECKATGHICHPLCSSEGCWGPGPKYCMSCQNFSRGKECVGKCN
ILEGEPREFMENSECVQCHPECLPQAMNVTCTGRGPGNCVKCAHYIDGPHCVKTCPAGVA
GENGTLIWKFADASHVCHLCHPNCTYGCIGPGLEGCAANGPKIPSIATGIVGGLLLVLVL
ALSVGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKVKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLVPQ
QGFFHSPATSRTPLLSSLSASSNTPTVTCVDRSGSYPLKEESFLQRYSSDPTGALTEDSM
DDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLYPAPGRDPQYQNSRSNAVDNPEYLNTT
HPACINGVLDGPALWAQKGSHQISLDNPDYQQAFFPKEAKSNGIFKGPAAENTEYLRAAP
AGSDFTGA
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgcgactctcgcgggcgggccgcgcggcgctcctggtgctgctggccgcgcacttcccg
gcgagtctagcgctggaggagaagaaagtttgccaagggacaagtaacaagctcacccag
ctgggcacttttgaagaccactttctgagcctccagaggatgttcaacaactgtgaggtg
gtccttgggaatttggaaattacctacatgcagagtggttacaacctttcttttctcaag
accatccaggaggttgccggctatgtactcattgccctcaacacagtggagaagattcca
ttggaaaacctgcagatcatccgaggaaatgtgctttatgaaaacacccatgccttagcc
gtcttatccaactatggagcaaacaaaaccggactgagggagctgcccttgagaaactta
caggaaattttgcaaggtgccgtgcgattcagtaacaaccctgtcctctgcaacatggag
accatccagtggcgggacatcatcaacactgattttctaagcaacgtgacaggggacttt
cagaaccagcagggcaactgctcgaagtgtgatccaggctgtctcaacagaagctgctgg
ggtgctggggaggagaactgccagaaattgaccaaaatcatctgtgcccagcagtgttcc
gggcgctgccgcggcaggtcccccagtgactgctgccacaaccagtgtgccgctggctgc
acggggccacgggagagcgactgcctggtctgccgcaggttccgtgatgaagccacctgc
aaggacacatgtccgccgctcatgctctatgaccctaccacctacgaaatgaaggtcaac
ccgctggggaaatacagctttggcgccacctgtgtcaagaagtgtccccggaactacgtg
gtgacagaccacggctcgtgcgtccgcgcctgcagctctgacagccaggaggtagaggaa
gatggtgtccgcaagtgcaaaaagtgcgacgggccttgtgccaaagtttgtaacggaata
ggaatcggtgagtttaaagacacactttccataaatgctacaaacattaaacacttcaga
aactgcacatccatcagtggagatcttcatatcctgccagtagcatttaggggggactcc
ttcacacgtactgcacctctggacccgaaagaactggacattctaaaaactgtaaaagaa
ataacagggtttttgctgattcaggcctggcccgaaaacaggactgacctccatgcgttt
gagaacctggaaatcatacgtggcagaacgaagcaacatggccagttttctcttgcggtt
gtcggcctggatataacatccttgggattacgctccctcaaggagataagtgatggcgat
gtgataatttcaggaaatcgaaacttgtgctatgcaaatacgatacactggaaaaaactt
tttgggacctcaactcagaaaaccaaaattttaaacaacaggagtgataaagagtgcaag
gccacgggccatatctgtcacccactgtgctcatcagagggctgctggggacctggaccc
aaatactgcatgtcctgccagaacttcagtcgtggcaaggagtgtgtgggaaagtgcaac
attctagagggagagcccagggagttcatggagaattccgagtgtgtgcagtgccatcca
gaatgcctgccccaggccatgaatgtgacctgcactggacgcggaccaggcaactgtgta
aagtgtgcccactacattgatggccctcactgcgtcaagacctgccctgctggagtcgcg
ggagagaatggcaccctgatctggaagtttgcagatgccagtcacgtgtgtcacctgtgc
caccccaactgcacctatggctgtatagggccaggtcttgaaggctgtgcagcaaatggg
cccaagatcccgtccattgccacgggcatcgtgggcggcctgctgctggtgttggtgctc
gccctgagcgtcggcctcttcatgcgcaggcgccacatcgtgcgcaagcgcacactgcgc
cggctgctgcaggagcgtgagctcgtggagcctctgacgcccagcggagaagctcctaac
caagctcttttgaggatcttaaaggaaacggaattcaaaaaagtcaaggtgttgggctca
ggagcattcggcaccgtgtacaagggactctggatcccagaaggcgagaaggttaaaatt
cctgtagctatcaaggaattaagagaagccacgtctcccaaagccaacaaggaaattctt
gatgaggcctacgtgatggccagtgtggacaacccacatgtgtgccgcctcctgggcatc
tgcctgacctccacagtgcagctcatcacacagctcatgcccttcggctgcctgctggac
tacgtccgtgagcacaaagacaacatcggctcccagtacctgctcaactggtgtgtgcag
atcgcaaagggcatgaattacctggaagaccggcgcttggtgcatagggacctggcagcc
aggaacgtgctggtgaagacgccgcagcacgtgaagatcacagacttcgggctggccaag
ctgctgggtgccgaggagaaggagtatcatgcagaaggaggcaaggtccctatcaaatgg
atggctttggaatcaattttacaccgaatttatacccatcagagtgatgtctggagctat
ggagtcactgtttgggagttgatgacctttggatccaagccttatgatggaatccctgcg
agtgagatctcaactgtcctggagaaaggagagcgcctcccacagccacccatctgcacc
atcgacgtctacatgatcatggtcaagtgctggatgatagatgcagacagtcgcccaaag
ttccgtgagttgatccttgaattctccaagatggcccgagacccacagcgctaccttgtc
atccagggggacgagagaatgcatttgccaagccctacggactccaacttttaccgcgcc
ctgatggatgaggaggacatggaggacgttgtggatgctgatgagtacctcgtcccccag
cagggcttcttccacagccccgccacctctcggacacccctcctcagctccctgagcgcc
tccagcaacactcccactgtgacttgcgttgatagaagtgggagctaccctctcaaggaa
gaaagcttcctgcagcgctacagttcagaccccactggtgccctcaccgaggacagcatg
gacgacgctttcctcccagtacccgaatatgtaaaccaatctgttcccaaaagacccgca
ggctctgtccagaaccctgtctatcacaatcagcctctatatccagctcctggcagagac
cctcagtaccaaaattcacgcagcaacgccgtggacaaccctgagtatctcaacaccacc
catcctgcctgtatcaatggtgtactcgacggccctgccctctgggctcagaagggcagt
caccaaattagcctagacaaccctgactaccagcaggccttttttcccaaggaagccaag
tcgaatggcatctttaagggacctgcagctgaaaatacagaatacctgcgggcagcacca
gcaggcagtgactttactggggcctga

DBGET integrated database retrieval system