KEGG   Ovis aries (sheep): 780519
Entry
780519            CDS       T03117                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04020  Calcium signaling pathway
oas04066  HIF-1 signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04520  Adherens junction
oas04530  Tight junction
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05215  Prostate cancer
oas05219  Bladder cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    780519 (ERBB2)
   04012 ErbB signaling pathway
    780519 (ERBB2)
   04066 HIF-1 signaling pathway
    780519 (ERBB2)
   04020 Calcium signaling pathway
    780519 (ERBB2)
   04151 PI3K-Akt signaling pathway
    780519 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    780519 (ERBB2)
   04520 Adherens junction
    780519 (ERBB2)
   04530 Tight junction
    780519 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    780519 (ERBB2)
   05206 MicroRNAs in cancer
    780519 (ERBB2)
   05205 Proteoglycans in cancer
    780519 (ERBB2)
   05230 Central carbon metabolism in cancer
    780519 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    780519 (ERBB2)
   05226 Gastric cancer
    780519 (ERBB2)
   05219 Bladder cancer
    780519 (ERBB2)
   05215 Prostate cancer
    780519 (ERBB2)
   05213 Endometrial cancer
    780519 (ERBB2)
   05224 Breast cancer
    780519 (ERBB2)
   05223 Non-small cell lung cancer
    780519 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    780519 (ERBB2)
   01524 Platinum drug resistance
    780519 (ERBB2)
   01522 Endocrine resistance
    780519 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    780519 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    780519 (ERBB2)
   04090 CD molecules [BR:oas04090]
    780519 (ERBB2)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     780519 (ERBB2)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   780519 (ERBB2)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   780519 (ERBB2)
CD molecules [BR:oas04090]
 Proteins
  780519 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 780519
NCBI-ProteinID: XP_014954244
Ensembl: ENSOARG00000011865
UniProt: A0A6P3YL94
LinkDB
Position
11
AA seq 1258 aa
MELAAWCRWGLLLALLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPADASLSFLQEIQEVQGYVLIAHNRVSQVPLQRLRIVRGTQLFEEHYALAVLDNG
DFLEGAAPAAGTASGGLQELQLRSLTEILKGGVLIQRNPQLCHQDTILWEDIFHKNNQLP
LKQIDTNRSRACAPCSPACKAPNCWGESSEDCQSLTRTVCASGCARCKGPQPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCAPVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFAGDPDSNITPLQAEQLKVFESLEEITGYLYISAWPDSLP
DLSVFQNLRVIRGRVLHDGAYSLTLQGLGISWLGLRSLRELSSGLALIHRNARLCFVHTV
PWDQLFQNPHQALLHSANRPENECVGEGLACYPLCAQGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLQGLPREYVKDRYCLPCHPECLPQNGSVTCFGSEADQCVACAHYKDPPFCV
ARCPSGVKPDLSFMPIWKFPDEEGICQPCPINCTHSCVDLDDKGCPAEQRASPVTSIIAA
VVGVLLVVLVGLVFGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKE
TELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGV
GSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLE
DVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRR
RFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVK
CWMIDSECRPRFRELVTEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDL
VDAEEYLVPQQGFFCPDPAPGAGGTAHRRHRSTSTRSGGGELTLGLEPSEEEPPRSPLAP
SEGAGSDVFDGDLGMGAAKGLQSLPQHDSSPLQRYSEDPTVPLSPEADGYVAPSTCSPQP
EYVNQPEVRPQPPSPLEGPLPPPRPAGSTLERPKTLSPGKNGVVKDVFAFGAAVENPEYL
APRGRAAPQSHPSPAFSPAFDNLYYWDQDPSERGTPSSSFEGTPTAENPEYLGLDMPV
NT seq 3777 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcctgccccccggagcc
gcgggcacccaagtgtgcaccggcacagacatgaagctgcggctgccagccagtcccgag
acccacctggacatgctacgccacctctaccaaggctgtcaggtggtgcagggtaacctg
gagctcacctatctgcctgctgatgccagcctctccttcctgcaggaaatccaggaggtg
cagggctatgtgctcatcgctcacaatcgagtgagtcaggtcccactgcagagactgcga
atcgtgcgaggcactcagctctttgaggaacactacgccctggccgtgctggacaatgga
gactttctggaaggtgctgcccctgctgcgggcacggcctcaggagggctgcaggagctg
cagctgcgaagcctcacagagatcctcaagggaggggtcttgatccagcggaacccccag
ctctgccaccaggacacgattttgtgggaggatatcttccacaagaacaaccagctgccc
ctcaagcagatagacaccaaccgctcacgggcctgcgcaccctgttctccagcttgtaaa
gctcccaactgctggggagaaagttctgaggactgtcagagcttgacgcggaccgtctgt
gccagtggctgtgcccgctgtaagggcccacagcccaccgactgctgccacgagcagtgc
gctgccggctgtactggccccaagcactctgactgcctggcctgcctccacttcaaccac
agcggtatctgtgagctgcactgcccagctctggtcacctacaacacggacaccttcgag
tcgatgcccaaccccgaggggcgttataccttcggtgccagctgtgtgaccgcctgtcct
tacaactacctgtctacggatgtgggatcctgcaccctggtttgtcccctgaacaaccaa
gaggtgacagctgaggatggaacccagaggtgtgagaaatgcagcaagccctgtgcccca
gtgtgctacggtctgggcatggaacacctgcgggaggtgagggcagtcaccagtgccaac
atccaggagtttgccggctgcaagaagatttttgggagcctggcgtttctgccagagagc
tttgcaggggacccagactctaacatcaccccactgcaggctgagcagctcaaagtgttt
gagtctctggaggagatcacaggttacctgtacatctcagcgtggccagacagcctgcct
gacctcagcgtcttccagaacctgcgagtaatccggggacgagttctgcatgatggtgcc
tactcgctgacgctgcaagggctgggcatcagctggctggggctgcgctcgctgcgggaa
ctgagcagcgggctggccctcatccaccgcaacgcccgcctctgcttcgtacacacggtg
ccctgggaccagctcttccagaacccccaccaggctctgctccacagcgccaacaggcca
gagaatgagtgcgtgggtgagggcctggcctgctacccactgtgcgcccaagggcactgc
tggggtcccgggcccacccagtgcgtcaactgcagccagttccttcggggccaggaatgc
gtggaggaatgccgagtactacagggactacaggggcttccccgggagtacgtgaaggac
aggtactgtctgccgtgccaccccgagtgtcttccccagaatggctcagtgacctgcttt
ggctcggaggctgaccaatgtgtggcttgtgcccactacaaggatcctcccttctgcgtg
gctcgctgccccagtggtgtgaagcctgacctctccttcatgcccatctggaagtttcca
gatgaagagggcatatgccagccatgccccatcaactgcacccactcctgtgtggacttg
gatgacaagggctgtcccgccgagcagagagccagccctgtgacatccatcattgccgct
gtggtgggcgttctgctggttgtccttgtggggctggtgttcggcatcctcattaagcga
aggcggcagaagatccggaagtatacaatgcggcggctgctgcaggagacggagctggtg
gagcccctgacgcccagcggagcgatgcccaatcaggctcagatgcggatcttaaaagag
acagagctgaggaaagtgaaggtgctaggatctggagcttttggcaccgtctacaagggc
atctggatccccgatggggaaaatgtgaaaatccccgtggccatcaaggtgttgagggaa
aacacatctcccaaagccaacaaggaaatcttggacgaagcatatgtgatggctggtgta
ggctccccatatgtgtcccgcctcctgggcatctgcctgacatccacagtgcagctggtg
acacagcttatgccctatggctgcctcctcgaccacgtccgagaacaccgtgggcgcctg
ggctcccaggacctgctgaactggtgtgtgcagattgccaaggggatgagctacttggag
gatgtgcggctcgtgcatagggacctggctgcccggaacgtgctggtcaagagtcccaac
catgtgaagattacagacttcgggctagcgcgactgctagacattgacgagacagagtac
cacgcagatgggggcaaggtgcccatcaagtggatggcattggagtccattctccgccgg
cggttcacccaccagagtgacgtgtggagctatggtgtgactgtgtgggagctgatgact
tttggggccaaaccttatgatgggatcccagcccgggagattcctgacctgctggagaag
ggagaacggctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaa
tgttggatgattgactctgaatgtcggccgaggttccgggagttagtgactgaattctcc
cgcatggccagggacccccagcgctttgtggtcatccagaatgaagacttgggccctgct
agccccctggatagcaccttctaccgctcgctgctggaggatgacgacatgggagacctg
gtggatgcggaggagtacctggtaccccagcagggcttcttctgcccagaccctgcccca
ggagctggaggcacggcccaccgcaggcaccgcagcacatccaccaggagtggtggtggt
gagctgacactggggctggagccctctgaggaggagccccccagatctccgctggcacct
tccgaaggggcaggctctgatgtgtttgatggcgacttgggaatgggggcggccaagggg
ctgcagtccctcccccaacacgactctagccctctacagcggtacagcgaggaccccaca
gtacccctttctcccgaggctgatggctacgttgccccctcgacctgcagcccccagccc
gaatacgtgaaccagccagaggttcgcccacagcccccgtcacccctagagggtcctctg
ccgcctcctcgacctgcaggttccactctggaaaggcccaagacgctctcccctgggaag
aatggggttgtcaaagacgtttttgcctttggggctgccgtggagaaccccgagtacttg
gcaccccggggcagggccgcccctcagtcccacccttctccagccttcagcccagccttt
gacaacctctactactgggaccaggacccatcagagcggggcactccatccagctccttt
gaagggacccctacggcagagaaccctgagtacctgggcctggacatgccagtatga

DBGET integrated database retrieval system