KEGG   Ovis aries (sheep): 780520
Entry
780520            CDS       T03117                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04064  NF-kappa B signaling pathway
oas04210  Apoptosis
oas04380  Osteoclast differentiation
oas04620  Toll-like receptor signaling pathway
oas04621  NOD-like receptor signaling pathway
oas04622  RIG-I-like receptor signaling pathway
oas04623  Cytosolic DNA-sensing pathway
oas04625  C-type lectin receptor signaling pathway
oas04657  IL-17 signaling pathway
oas04658  Th1 and Th2 cell differentiation
oas04659  Th17 cell differentiation
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04668  TNF signaling pathway
oas04722  Neurotrophin signaling pathway
oas04920  Adipocytokine signaling pathway
oas04926  Relaxin signaling pathway
oas04931  Insulin resistance
oas05132  Salmonella infection
oas05134  Legionellosis
oas05135  Yersinia infection
oas05140  Leishmaniasis
oas05142  Chagas disease
oas05145  Toxoplasmosis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05171  Coronavirus disease - COVID-19
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05215  Prostate cancer
oas05220  Chronic myeloid leukemia
oas05222  Small cell lung cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    780520 (NFKBIA)
   04668 TNF signaling pathway
    780520 (NFKBIA)
   04024 cAMP signaling pathway
    780520 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    780520 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    780520 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    780520 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    780520 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    780520 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    780520 (NFKBIA)
   04660 T cell receptor signaling pathway
    780520 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    780520 (NFKBIA)
   04659 Th17 cell differentiation
    780520 (NFKBIA)
   04657 IL-17 signaling pathway
    780520 (NFKBIA)
   04662 B cell receptor signaling pathway
    780520 (NFKBIA)
   04062 Chemokine signaling pathway
    780520 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    780520 (NFKBIA)
   04926 Relaxin signaling pathway
    780520 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    780520 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    780520 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    780520 (NFKBIA)
   05203 Viral carcinogenesis
    780520 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    780520 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    780520 (NFKBIA)
   05215 Prostate cancer
    780520 (NFKBIA)
   05222 Small cell lung cancer
    780520 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    780520 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    780520 (NFKBIA)
   05135 Yersinia infection
    780520 (NFKBIA)
   05134 Legionellosis
    780520 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    780520 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    780520 (NFKBIA)
   05161 Hepatitis B
    780520 (NFKBIA)
   05160 Hepatitis C
    780520 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    780520 (NFKBIA)
   05164 Influenza A
    780520 (NFKBIA)
   05162 Measles
    780520 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    780520 (NFKBIA)
   05163 Human cytomegalovirus infection
    780520 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    780520 (NFKBIA)
   05169 Epstein-Barr virus infection
    780520 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    780520 (NFKBIA)
   05140 Leishmaniasis
    780520 (NFKBIA)
   05142 Chagas disease
    780520 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    780520 (NFKBIA)
   04131 Membrane trafficking [BR:oas04131]
    780520 (NFKBIA)
Transcription factors [BR:oas03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    780520 (NFKBIA)
Membrane trafficking [BR:oas04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    780520 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 780520
NCBI-ProteinID: NP_001159656
Ensembl: ENSOARG00000007502
UniProt: C8BKC0 A0A6P9FQP9
LinkDB
Position
18
AA seq 314 aa
MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQQLHSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc
aagaaggagaggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtatgagcagatggtgaaggagctgcgagagatccgcctcgagccgcaggaggcgccg
cgcggcgccgagccctggaaacagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaggccctcaccatggaagtggtccgccaagtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc
actaaccagccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg
ggagtcctgactcagccccggggaacccagcagctccactccattctgcaggccaccaac
tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag
ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc
ctccatctggcagtggacctgcagaatcccgacctggtgtcactcctgttgaagtgtggg
gctgatgtcaacagagtcacctaccagggctactccccgtaccagctcacgtggggccgc
cccagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagacactg
ccagagagcgaggatgaggaaagctatgacaccgaatcagagttcacagaagatgagctt
ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system