KEGG   Octadecabacter antarcticus: OAN307_c48340Help
Entry
OAN307_c48340     CDS       T02538                                 

Gene name
glpD2
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
oat  Octadecabacter antarcticus
Pathway
oat00564  Glycerophospholipid metabolism
oat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oat00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    OAN307_c48340 (glpD2)
Enzymes [BR:oat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     OAN307_c48340 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGI70179
UniProt: M9RC38
LinkDB All DBs
Position
4766214..4767680
Genome map
AA seq 488 aa AA seqDB search
MNDLASATSSASTKLFHGGLRYLEYFEIRLVREALIERETLLRAMPHISWPMRFVLPYHK
DMRFEGSTPTSKILNIAMLWMKGRRPAWLIRLGLFMYDTLGGRKILPGTTTVDLRTALEG
EGIEDRFEKAYEYSDCWIEDSRLVVLNARDAENRGAKIMERTKVISTIRHDDHWVVQLLD
QDTGEETTICAKMLVNAAGPWVGDIIQTKVRLNSSEGVRLVRGSHIVTKRLFEHDKSYFF
QGTDGRIIFAIPYETDFTLIGTTDAEQDDPNVKPVCTDAERDYLISFANQYFKRDITADD
VVWRYSGVRPLYDDGAKSATAATRDYTLKVDTDGGAPILNIFGGKITTYRRLAQSALGMI
SPFFEDVSADWTASVPLPGGDFPVDGVATLIADLKQANPLLDDPWAKRLVRAYGTDAKNV
TTNAKSAADLGQDFGASLTEAEVTWLMDHEYARRGEDVVWRRNKLGLRMTDDQIANLDGW
MVARSNAA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatctcgcgtcagcaacatccagtgcgtcgacaaaactgtttcatggcggtctt
cgctatcttgaatatttcgaaattcgtttggtccgtgaggcattgatcgaacgcgaaaca
ctgttgcgcgccatgccacatatcagctggccgatgcggtttgtgctgccctatcacaaa
gacatgcggtttgaaggatcgacgccaacgtccaaaattctgaatatcgcaatgctatgg
atgaagggccgtcgccctgcgtggctgatccggcttggcctgttcatgtatgacaccctc
ggcggacgcaaaattttgcccggcaccacaaccgtcgatctgcgcaccgcgctcgaaggc
gaaggaatcgaggatcggttcgaaaaggcctatgaatattccgactgctggatcgaagat
tcacggctcgttgtgctgaacgcgcgagacgcggaaaatcgcggtgccaagattatggag
cgtaccaaagtcatttcgacgatccgccatgacgatcactgggtggtgcaattattggac
caagacaccggcgaagaaactacaatttgcgccaagatgctggtgaacgcggcaggccct
tgggttggtgacattatccagaccaaagtgcggctaaactcatccgagggcgtgcgattg
gtgcgtggatcacacatcgtgacgaagcgcctatttgaacacgataaaagctatttcttt
caagggaccgacgggagaatcatctttgcgattccttacgaaactgattttaccttgatc
gggacgacagacgcggaacaagatgatccaaatgtgaaaccggtctgtaccgacgcagaa
cgcgattacctcatctcattcgcaaatcagtattttaagcgcgacatcacggctgatgac
gtcgtttggcgctattcgggtgtacgtccgctatacgacgatggtgccaaaagcgcgact
gcggcgacgcgggactatactttgaaggtcgacaccgatggtggcgcgcccatcctgaat
atctttggcggcaagatcaccacctatcgccgcctcgcgcagagcgcattaggcatgatt
agtcccttttttgaagatgtatccgcagattggactgcaagcgttccgctgccaggtggg
gattttccggtagacggtgtcgcaactctgatcgctgatctgaaacaggccaatccgtta
cttgatgatccttgggcaaagcgacttgtgcgcgcctatggcaccgacgcgaagaatgtg
accacaaacgcgaaatccgccgccgatctcggccaagattttggcgcgtctttgaccgaa
gcagaagtaacatggttgatggatcatgaatatgcacgtcgcggagaagacgtcgtgtgg
cgtcgcaataagcttggtcttcgcatgacggacgatcaaatcgcaaatctggatggctgg
atggttgcacgaagcaatgcagcataa

DBGET integrated database retrieval system