KEGG   Osmia bicornis bicornis: 114871737
Entry
114871737         CDS       T06109                                 

Definition
(RefSeq) uncharacterized protein LOC114871737 isoform X1
  KO
K20017  Bcl-2 family protein
Organism
obb  Osmia bicornis bicornis
Pathway
obb04214  Apoptosis - fly
obb04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:obb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    114871737
   04215 Apoptosis - multiple species
    114871737
SSDB
Motif
Pfam: Bcl-2 HTH_Tnp_Tc3_2
Other DBs
NCBI-GeneID: 114871737
NCBI-ProteinID: XP_029033853
LinkDB
Position
Unknown
AA seq 315 aa
MRPDFRLVVQQEMPLAAPEKPEWHEHTTEDSSMSGLVGSLRGLEDNSGNTTQPYRRNSLA
LSLHSNLAAFPAANNHEVSSFHVVDSARRRFSNVSDVVSRKISHTIRWRTVSASVELTVS
QGSSLCAQYIRNRLKRSGIFHRKLGLKRMRSVMLLPGGAVVGEVYPELVSIGAELEKMHP
NLFNRVARQIGCGSFSTEQSACEAIVDVSREMIRNGEMNWSKVIALYAVAGGIAVDCVRQ
GKPEFLPAIQRGMTDVLEEDLAVWIQANGGWSALTTRYRPPTKETIWYSRKLGLLFIITI
LIIIMISISLKLLVL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaggccggactttcgattggtggtccaacaggaaatgcctctggcagcgcctgagaag
cctgaatggcacgaacacaccacggaggattcttcgatgtctggactggttggatctctg
cgaggcttggaggacaattccgggaatacaacgcagccttatcgcaggaacagccttgct
ttatcattacattccaatttagctgcttttccggcagctaataatcatgaagtctcgtct
ttccatgtggtcgattcagcaaggaggagattcagcaacgtcagcgatgttgtttccagg
aagatatctcatacaatacgctggaggactgtttcagcttctgttgagcttacggtttct
cagggatcttcattatgcgctcaatacattcgaaaccgattgaaacgatcaggaatcttc
catcgaaaacttggactaaaaagaatgagaagtgttatgttgcttcctggtggagcagtt
gtgggagaagtatatccagagttagtatcaattggagctgagcttgaaaaaatgcatcca
aatttattcaaccgtgtagcacgacagatcggttgtggtagcttctccactgaacaatct
gcttgcgaggctatcgtcgatgtctccagggaaatgatcaggaatggagagatgaattgg
agtaaagtaatagccctttatgcggttgctggtggcattgctgtagattgtgtacgccag
ggaaaacctgaattcctacctgccatacaaagaggcatgacagatgttctggaagaggac
cttgctgtatggatacaggccaatggaggatggtctgctttaacaacacggtacagaccg
ccgacaaaagagactatatggtactcacggaaactcggattgttatttataattaccatt
ttaataattatcatgatctccatatctttaaaactattagttttataa

DBGET integrated database retrieval system