KEGG   Osmia bicornis bicornis: 114872430
Entry
114872430         CDS       T06109                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
obb  Osmia bicornis bicornis
Pathway
obb00230  Purine metabolism
obb01100  Metabolic pathways
obb04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:obb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114872430
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    114872430
Enzymes [BR:obb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     114872430
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258
Other DBs
NCBI-GeneID: 114872430
NCBI-ProteinID: XP_029035441
LinkDB
Position
Unknown
AA seq 996 aa
MLRRRYTSNEHSYLSAGRPSNLLRTSFSSAKLETLYRASSLQQRRGGLECFLLSALLYGA
QTIVVPGLELLVRGLTAVFLGLNLGLLAWAKCNPKAKDALWSVVPHVAWLLSTAQLLAQL
FLKSTEVTPRNGLDWLLLLLYLLFATLPLRLSLCALLAFGTTLTYIVSVVGLSKAPAQIP
IDVLVLTLTLSVGAMLLGASSYSLTEFQQRRAFLETKQSLEVQLVIEEQSAEQERLLLSV
LPEHVAVKMRQDLGASLDTQFKKIYMSRHENVSILYADIVGFTAISSTYSASELVKILNE
LFARFDQLSERYEQLRIKILGDCYYCISGAPVERSDHAVLCVHMGLSMVDAIKYVQQTTN
SPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGRAGRVHISNVTLSFLNG
EFEVEPAHGEDREEALKKAGIVTYFIVRALKPFKPAVTKSLASLTDVENSRTSMENTRDG
RYNKDTEEFWQRLRKELDSKGGVVDLKGHAHWFSLRFKDKKVESAFHNAEEAFSPLSLLG
GPLVMVCSSPVWRFQPWGPFTWGGIVVVTLFAIVLGGATCLGSAVKAMWLRRTLALLMIF
SLGDFLLLDMFNCVVIEEAIPRFNGTIPLSARCPYPSYYSYMGVLTLVAISMPNYIYYLG
KTYLMFGIAGIQCAVNIYLLGGRLDWEDYASSPLDPPIFPSKYYLSITLFVVAICLVIVS
RYTEKSRRMLYLRGREVVAQRERAADMKRRNGALIYNILPPHVAAYYLFSARHHGDLYSQ
SYSEVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFDAILDQCKFRDIIKIKTI
GSTYMAASGITESVESENAPRWCHLATLVEFALELKKALSSINEQSFNHFVLKMGINYGP
VIAGVIGARKPHYDIWGNTVNVASRMESTGKVGCIQVTDETRKILEPFGFGFEQRGMVFV
KGKGQLLTHYLVSKDGVSLNLDSDLPVEPTHPIIYQ
NT seq 2991 nt   +upstreamnt  +downstreamnt
atgttacgaagaagatacacctcgaacgagcattcctacctgagcgcgggcaggccgtcg
aacctgctgcggaccagcttcagcagcgccaagctagagacgctctatcgtgcttcgtcc
cttcagcaaaggcggggtggcctcgagtgtttcctcttatcggcactcctttatggcgca
caaacgatagtagtgccaggtctggagctactggtccgaggtcttacagccgtcttcctg
ggactgaatcttggtctattggcctgggccaagtgcaaccccaaagcaaaggatgcgctc
tggtcggtggtccctcacgtggcctggctactctccaccgcacagctactcgctcagctg
ttcctcaagtccaccgaggtcacgcctagaaacggactagactggctgttgctcttgctc
tacctgctcttcgccactctgcccctcaggctctccctctgtgccttgctcgcgttcggc
accacgctaacttacatcgtctccgtggtcggactgtccaaggcacccgcccagataccc
atcgatgttttggtgctgacgttaacgttgtcggtgggcgcgatgttgttgggtgcttcc
agttactccttaacggagttccagcagcgtcgagcctttctggagactaaacagagcctg
gaggttcaattagtgatcgaagagcaaagtgccgaacaagagaggctgcttctgagcgtg
ttgccggaacacgtggctgtaaaaatgcgacaggacctcggcgcctcgttggacacgcag
ttcaagaagatctacatgtccaggcacgagaacgtatcgatcctgtacgcggatatcgtc
ggtttcacggccatctcctccacctacagcgccagcgaactcgtgaaaatcctgaacgag
ttgttcgcgagattcgatcaactcagcgagaggtacgagcagctacgaattaaaatcctc
ggcgactgttactactgcatcagtggagcaccggtcgaaaggtcagaccacgctgtcctc
tgcgttcacatgggcctgtcgatggtggacgccatcaagtacgtgcaacagacgaccaac
agccctgtggacatgagggtgggcatacacaccggtgcagttctggccggtgttctcggt
cagaggcaatggcaattcgatgtttacagcaaggacgtcgagttggcgaacaagatggag
agcagcggaagagcggggagggtgcacatctcgaacgtgacacttagcttcctgaacggg
gaattcgaggtcgagccagcccatggcgaggacagagaagaggcactcaagaaggcgggt
atcgtcacttacttcatagtgcgggcgttgaaacccttcaagccagccgtgacgaagagt
cttgcctcactgacggacgtggaaaattcgcgaacttcgatggaaaataccagagacggg
aggtacaacaaggacacggaagagttctggcaaaggcttagaaaggagctcgatagcaaa
ggtggagtggtggatctgaaaggacacgcgcattggttctccttacgtttcaaagacaag
aaggtagaatcagcgtttcacaatgccgaagaagccttctccccgttgtcgttactcgga
ggaccgctggtgatggtttgttcctcgccggtatggaggtttcaaccctggggaccattt
acctggggtggaatagtggtggtcactttgtttgctatcgttttgggcggtgccacttgt
ttgggcagcgccgttaaagctatgtggctgaggagaacccttgctttgctgatgatcttc
tccctcggggattttctgcttctcgacatgttcaactgtgtggtgatcgaggaagcgatt
cctcgcttcaacggcactatacccttgtcagcaaggtgtccatatccctcgtactattca
tacatgggcgtgctgacgctggtggcgatctctatgccgaattacatctactacctgggg
aaaacgtacttgatgttcggaatcgcaggtatccagtgtgccgtcaacatctatctactt
ggagggaggctcgattgggaagattatgcctcgtctccattagacccaccaatttttcct
tcaaagtattacctgtccatcactcttttcgtcgtggccatctgtttggtcatcgtttcc
agatacacggagaaatcgaggaggatgctttatctacggggcagagaggtggtcgcgcag
agagagagggcggctgacatgaagcgtcgaaacggtgcccttatatacaatatcctgccg
ccccacgtggcagcttactacctgttcagcgccagacaccacggcgacctatacagtcaa
agttactcggaggtgggcgtactattcgccagcatgccaaactttgccgacttctacagc
gaggagagcataaacaaccagggtctcgagtgtcttaggttcctcaacgaagtcatatca
gatttcgacgcgatcctcgatcagtgtaagttccgagacatcatcaaaatcaagacaata
ggttctacgtacatggcggcatcagggatcacggaatcggtggaatctgagaacgcgcca
cgatggtgtcacctggcgaccctcgtcgaattcgctttggaactgaagaaagcattgtcc
agtatcaacgagcagagtttcaatcactttgtcttgaaaatgggtatcaattatggcccg
gtaattgccggggtcatcggggcgaggaaacctcattacgacatttggggcaacacggtg
aacgtggcgtccaggatggagagcactggaaaagtgggttgtatccaggtgacggacgag
acacggaaaatcctggagcccttcggttttggtttcgagcaacgtggcatggtattcgtg
aaaggcaaaggtcaactactcactcactatctggtatccaaggatggcgtgtccttgaac
ttggacagcgatctaccagtcgaacctactcatcccatcatctaccagtag

DBGET integrated database retrieval system