KEGG   Osmia bicornis bicornis: 114872802
Entry
114872802         CDS       T06109                                 

Definition
(RefSeq) uncharacterized protein LOC114872802
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
obb  Osmia bicornis bicornis
Pathway
obb04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:obb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114872802
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114872802
NCBI-ProteinID: XP_029036240
LinkDB
Position
Unknown
AA seq 142 aa
MKVIPKMARLTIQHPNVEMQEERRGHSARRKLFQEDDDNESKSGRNSGVEDNIANCFYEE
ARKNRENAKERWNFDFEKEEPLPGRYVWVKLDEHGNEIGAPLESSNRVENLRTMQEEDTQ
DDDVTMEEHLDERDGENMTDST
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaaggtgatcccaaagatggcccggctcacgatacagcacccaaacgtcgagatgcaa
gaggaaagaaggggtcattcggcaagaagaaaactgttccaagaagacgacgataacgag
agtaaatcagggcgaaactcaggtgtcgaggacaacatcgcgaattgtttctacgaggag
gctcgaaaaaatcgcgaaaatgctaaagaaaggtggaactttgattttgaaaaggaagaa
cccctacctggtcgttacgtgtgggtgaagcttgacgaacacggaaatgaaatcggtgca
cctttagagtcgagcaatcgggtagaaaatttgcgaacgatgcaggaagaggatacgcag
gatgacgacgtaacaatggaggaacacttggacgaaagagatggcgaaaacatgactgac
agtacgtga

DBGET integrated database retrieval system