KEGG   Osmia bicornis bicornis: 114873409
Entry
114873409         CDS       T06109                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
obb  Osmia bicornis bicornis
Pathway
obb04013  MAPK signaling pathway - fly
obb04214  Apoptosis - fly
obb04215  Apoptosis - multiple species
obb04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:obb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    114873409
   04391 Hippo signaling pathway - fly
    114873409
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    114873409
   04215 Apoptosis - multiple species
    114873409
SSDB
Motif
Pfam: TNFR_c6 CD225 Trp_oprn_chp HCO3_cotransp
Other DBs
NCBI-GeneID: 114873409
NCBI-ProteinID: XP_029037539
LinkDB
Position
Unknown
AA seq 298 aa
MPGEASRGYLLAVLLLLLLLLVGSRKAGCSTSAPRYPVCKPGFEFWSVERDTCWPCTRCA
PEFTLSPCTIYKDAICGPLSALELDWSFLSTKKRPETGQRSLEAVTSKMFWRFSDLDQEQ
IREESNDFVGRVENLERNIKKQTVNEPRRRETSSEEKILWDWQTGALILAICACILFFLV
AGCSALVYARQWRRMKKNFEPVGLEEISARLNLMVKAELAELVAGAPMNPGDPETRCQYL
EKLLDRKRETSVMVDWPEVTGNLYIEEREPPKGKRMHIARIHRNIETILNQKKNSTDQ
NT seq 897 nt   +upstreamnt  +downstreamnt
atgcctggggaggccagtcggggatatctgttggccgtgctgctgctgctgctgctgcta
ctggtcggttcccgcaaggctggctgctcgacatccgctccccgatatcccgtgtgtaaa
ccgggtttcgaattttggtcggtcgagcgtgacacctgttggccttgcaccagatgcgct
cctgaatttactttgagcccctgcaccatttacaaggatgctatttgcggaccactgtca
gcactcgagctcgattggtctttcctctcgacgaagaaacgaccggaaaccggtcaaaga
agcctcgaggctgtcacctcaaagatgttttggaggttctccgatctggatcaagaacag
atcagagaggaatcgaacgatttcgttggacgcgtagaaaacttggaacgtaacattaag
aagcagacggtaaacgagcctcgtcgaagggaaacgtcttcggaggagaaaatcctgtgg
gattggcaaactggagccctgatccttgccatctgtgcctgtattcttttcttcttggtc
gcaggatgctcagctctagtctacgcgagacagtggcggcgaatgaagaagaacttcgag
ccagtgggtttagaagagatctcggctcgattaaatttaatggtcaaggcagaactagcc
gaactggttgctggcgcgcccatgaacccgggtgatcccgaaacaaggtgccaatatctt
gagaaactcttggatcggaaaagggaaacttctgtgatggtcgattggccggaagtaacc
ggaaatctctacatagaagagagagagcctcctaaagggaagagaatgcatatcgctcga
attcatcgaaacatcgaaacgattttaaatcagaaaaagaattctaccgaccagtag

DBGET integrated database retrieval system