KEGG   Osmia bicornis bicornis: 114877652Help
Entry
114877652         CDS       T06109                                 

Definition
(RefSeq) NF-kappa-B inhibitor cactus
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
obb  Osmia bicornis bicornis
Pathway
obb04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:obb00001]
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    114877652
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:obb03000]
    114877652
   04131 Membrane trafficking [BR:obb04131]
    114877652
Transcription factors [BR:obb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    114877652
Membrane trafficking [BR:obb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    114877652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3
Motif
Other DBs
NCBI-GeneID: 114877652
NCBI-ProteinID: XP_029046350
LinkDB All DBs
Position
Unknown
AA seq 397 aa AA seqDB search
MWHPSRKTPMEKNVPENEEKCEKQHDSGDADSGFLSGGNLQVSSELIEGELIAATTAPQA
PEPMKIDSGVDLGLSESLSQLTLKQVTLNPLASGKVQAEPTVELIPVSSDKLKQYDASIL
QHESYQSTEKPFNEEPWQLYYTQDDDGDTQLHIAIVQGFLEAAFSLIRMAPHPCLLNILN
DDGQSPLHLAVLTRQPRIVRRLILAGANPALRNFRGNTALHLACATGDLTSAKALTDPLT
PLERNYLLYGKKVPALPQNLEQRNYDGEMCLHIAASSGHVELVRLLLRLGADLEAREALA
GKTALHLAVERGCRSVVAFLLQECRPCLDTRTYAGITAYQIALCFDGQLARELVRLGATP
QPLPESDSDSSDEDESTTTNYMPAIARLRQNVVGVKV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtggcatccgtcgagaaagacaccgatggagaaaaatgttccagaaaacgaagaaaag
tgtgagaagcagcacgactcgggtgacgctgattctggtttcctatccggaggaaatctt
caagtcagttccgagctgatcgaaggtgaattaattgccgcgacaaccgcaccccaggct
ccagaaccaatgaaaatagacagcggtgtagatctcggcctgagcgaaagcttgagccag
cttactctgaaacaagttacattgaatcctcttgctagtggcaaggttcaagccgaacca
actgtcgaattgattcctgtcagttccgacaagctgaagcaatacgatgcttcgatatta
caacacgaatcgtatcaatctacggagaagccgttcaatgaggaaccttggcagctttac
tacacacaggatgatgatggagacacgcagctgcacatagccatagtgcaaggtttccta
gaggctgcgttcagtttgataagaatggcacctcatccttgcctgttgaacatcttgaac
gacgatggtcagtctcccctgcacctggctgtgttgaccaggcaaccgaggatcgtaagg
cggctaattttggcaggtgcaaatccggcattgagaaacttccgtggtaatacggcccta
cacctggcatgcgccaccggggatcttacctcggcgaaagccctaaccgatcccttgacg
ccgctcgaaagaaattacctgctttacggaaagaaagtacctgcgctgccgcagaatctc
gaacaacggaattacgatggagagatgtgcttgcacatagcagcctcctcaggccacgtg
gagttggtgcgtcttctgttacgtcttggagcagacctcgaagccagagaagctttggcg
ggaaagacggctcttcatctggccgtggaacgcggttgtcgatcagtagtcgcgtttctt
cttcaagaatgcaggccttgtttggacacgaggacgtacgctggtatcactgcttatcag
atagcgttgtgtttcgatggccaactagccagggaactagtgaggctaggagcaacgcca
cagccgttacccgagtcggattccgacagcagcgacgaggatgagagcacgacgacgaat
tatatgccagcgatcgcgagactcaggcagaatgtggtcggcgttaaagtataa

DBGET integrated database retrieval system