KEGG   Lacunisphaera limnophila: Verru16b_00286Help
Entry
Verru16b_00286    CDS       T04567                                 

Gene name
luxQ_1
Definition
(GenBank) Autoinducer 2 sensor kinase/phosphatase LuxQ
Organism
obg  Lacunisphaera limnophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HATPase_c HisKA dCache_1 ABC_membrane_2
Motif
Other DBs
NCBI-ProteinID: AOS43243
UniProt: A0A1I7PHZ3
LinkDB All DBs
Position
321543..324335
Genome map
AA seq 930 aa AA seqDB search
MALAMGAVGFGLNGIHLPVFGETGIILGGLATLLATYCLGPWWGAATTALAFSHDWMNTG
LPWGLLLYTLEAVVVGWLKHRRNWHPLTAALAFWSFLGVPLALRVLQPPGTLPFPNNWAL
IALYPCNSLLMALGALTLKQMSWLQPTSGQPSNRDADTPLQRVLLRRLGLIIALSTALLG
LFLGRQLDLALRDLSATRLSGDGHEVARAVQDHLDRHQRVLTLLAATHEADTARAAPLDR
VRLNYPGFLSLRETDASGRIVASSPASDAAPDPTHEPATLPALLGSVSRRAAPGDALVVT
MRAPLPGPTGSPRGLIVGELVLDRLIEELALPAQLAHHTIVIVDRHQRVVASRGDLAWSP
LEAVGPGRFTANERQPDGETFLFNLTRPQRLERYLGTRQAIPDFGWEVYLAEPVWKTQRL
IARYYLAILCGAAAIAALAMLLARGLAAEITEPFLQLATTIRGLTNGHTDPAPPPVPQAS
RELTAIGRELQAVAIMFTRTNRRLVGAVAERDRTQAELRELLARLEEKVADRTRELDSAR
HAAVSANEAKSEFLASMSHELRTPLNVIVGMSELIAERHLGDLNERQSEGVRSIHESGRH
LLELINDILDLSKIESGMLELNVQPMEIADLCTASLRFVQTSAHQKSITLESALTDCPPV
ILADERRLKQILVNLLANAVKFTPAGGRVGLRVAPQSGGHSLRFEIWDTGIGIAPENHER
IFQPFQQIDSSLSRQYAGTGLGLALVRSMAQLQGGCVDVSSTLGSGSTFGVAIPLLLPPP
EPATPALREASAAPMPAPRARLLIAEDNAANRAVYDAFFEDSDCEIIHAVTGVEALHLVR
THRPDLILMDINMPEMDGLEAIRRLRADSTTEHLPIIAVTAFAMSTDRVRCLEAGASAYL
SKPIDLRELKRLVSRFTSSVRTNIPFEFVP
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggccttggccatgggagccgtgggctttggcctgaatgggatccacctgccggtcttt
ggggaaaccggcatcatcctcggcggcctcgccaccctcctcgccacctactgcctcggt
ccgtggtggggcgccgccaccaccgccctcgccttcagtcacgactggatgaacaccggc
ctcccctgggggctcctcctctacactctcgaggccgtcgtggtgggttggctcaagcat
cgccggaactggcaccccctgaccgccgccctggccttctggtccttcctcggtgtgccg
ctggccctgcgcgtcttgcagccgcctggcaccctgcccttcccgaataattgggcgctc
atcgccctttacccctgcaacagcctcctgatggccctcggcgccctcacgctcaagcag
atgagctggctgcaacccacgtccggccagccgtccaaccgggatgccgacacccccctg
caacgcgtcctgctccgccggctcgggctcatcatcgccctctccaccgccctgctcgga
ctcttcctcgggcggcaactcgacctggccctgcgcgacctgagcgccacgcggctctcc
ggcgacggccatgaggtcgcccgcgccgtccaggatcacctcgaccgccatcaacgcgtc
ctcaccctgctggccgcgacgcacgaggccgacaccgcccgcgccgccccgctcgaccgc
gtgcgcctcaactatccgggctttctctccctgcgcgaaacggatgcctccgggcggatc
gtcgccagctcgcccgcctcggatgccgccccggaccccacccacgaacccgccaccctg
ccagccctcctcgggagcgtttcccgccgcgcggcccccggggatgcactggtcgtgacc
atgcgcgccccgctccccggccccaccggttcaccccgcgggctgatcgtcggcgaactg
gtgctcgaccgcctgatcgaggaactggccctgccggcccagctcgcccaccacacgatc
gtcatcgtggaccgccaccagcgcgtcgtcgccagccgcggcgacctggcctggtcaccg
ctggaagccgtcggccccggtcgcttcaccgccaacgaacgccagccggatggcgaaacc
ttcctcttcaacctcacccgcccgcagcggctggaacgatacctcggcacccggcaggcg
atcccggatttcggctgggaggtctacctcgccgaacccgtctggaaaacccagcggctg
atcgcccgttactacctggccatcctgtgcggcgccgccgcgatcgccgcactcgcgatg
ctgctcgcccgcggcctggccgcggagatcaccgagccgttcctccaactcgcgaccacg
atccgcggcctcaccaacggccacacggatcccgccccgccccccgtcccgcaggcctcc
cgggaactcaccgccatcggccgcgaactccaggcggtcgccatcatgttcacccgcacc
aaccgccgcctcgtcggcgccgtggccgagcgcgaccgcacccaggcggaactgcgcgaa
ctgctcgcccgcctcgaggagaaggtcgccgaccgcacccgcgaactcgactccgcccgc
cacgccgccgtctccgccaatgaggcgaaaagcgagttcctcgccagcatgagccacgag
ctccgcacgccgctcaacgtcatcgtcggcatgtccgagctcatcgccgagcgccacctc
ggcgacctcaacgagcgccagtccgagggcgtgcgcagcatccacgaaagcggccgccac
ctgctcgagctcatcaacgacatcctcgacctctccaagatcgagtccggcatgctcgag
ctcaacgtccagcccatggagatcgccgacctctgcaccgccagcctccgcttcgtccag
acttccgcgcaccagaaatccatcaccctcgagtccgccctcaccgactgcccgcccgtc
atcctcgctgacgagcgccgcctgaagcagatcctcgtcaacctcctcgccaacgccgtc
aagttcacccccgcgggcggccgcgtcggcctgcgcgtcgccccccagtccggcggccac
tccctccgcttcgagatctgggacaccggcatcggcatcgccccggaaaaccacgagcgc
atcttccagccgttccagcagatcgacagctccctctcccgccagtacgccggcaccggg
ctcggcctcgccctcgtccgcagcatggcccagctccagggcggctgcgtcgacgtctcc
agcaccctcggctccggcagcaccttcggcgtcgcgatccccctcctcctcccgcccccc
gagcccgccacccccgccctgcgcgaagccagcgccgcccccatgcccgcgccccgcgcc
cgcctgctcatcgccgaggataacgccgccaaccgcgccgtctacgacgccttcttcgag
gacagcgactgtgagatcatccacgcggtcaccggggtcgaggccctccacctcgtccgc
acccaccggcccgacctcatcctcatggacatcaacatgccggaaatggacggcctcgag
gccatccgccgcctgcgcgccgacagcaccaccgagcacctgcccatcatcgccgtcacc
gccttcgccatgtccaccgatcgcgtccgctgcctcgaggcgggggccagcgcctacctc
agcaagcccatcgacctgcgcgagctcaagcgcctcgtctcccgtttcacctccagcgtc
cgcaccaacatccctttcgaattcgtcccatga

DBGET integrated database retrieval system