KEGG   Lacunisphaera limnophila: Verru16b_00585Help
Entry
Verru16b_00585    CDS       T04567                                 

Gene name
pknB_1
Definition
(GenBank) Serine/threonine-protein kinase PknB
Organism
obg  Lacunisphaera limnophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PD40 Kdo
Motif
Other DBs
NCBI-ProteinID: AOS43540
UniProt: A0A1D8ARN5
LinkDB All DBs
Position
647450..650548
Genome map
AA seq 1032 aa AA seqDB search
MATCPTCSLHYDAAATGGPCPRCALAGALTAANPAGTADYEFLGELGRGGMGVVSLVRQR
SLDRLVALKVIAATGDATGPARLLREARAAAAITHPHVVAVHEVGQGESGAFIAMEYCEG
GDLRARLKQGPLAPRAAATLGLKLAAAVARAHALGVLHRDLKPSNVLLTGTGEPKLCDFG
LSGSVAGTASEHTRTGILAGSPSYLAPEVLSGADPTPALDLYGLGAILYESVTGRPPFTG
DSPAAVLAQIGTTEPVAPRRLSPAVPADLETIILTCLAKDPAARYASAHALWADLENFLA
GRPIHARPPSPAGRLGRWARRNPALAAALAIIATGTVAATTLLVERNHQLHAALARSEIA
EADARLALRDSLFAQARGVRQSGRTGQRHEALRLLRASAALAGPTAAIRAEALAALALDD
WQWGKPQAVPHLRFSQLVGFDSALEHAAVPAADGTTIEVRRMRDGQVLRHLQTASASRVR
ETRYAPSDAWILAESEDGTQAVWAAGATVPHWIHQPAGIQYVGLDFASDDSGWWYTTTGN
QLMWCDARTGTGHPVGDPGTTIYGIKPSPDGTRLAVLRDDGLELWQLRDRQLLWRIDGDV
GSAAPAWTPDGHHLITEAYNGSPQIAVWDAADKRQVLTLRPGNMRASRFAMLPDGRRLLS
LDTDSVLRLWDITAGRELLRGQAGPHGLRLSADGRQAAGSSSFQQLARLDLAPLDVVQPL
GFALGQNSGLWRQAAVSPDGRWLVGQSTTFLRAYDLPQHRETARYRYAAGKTKALAFLPD
GGLLYSSPTLGIRRTRLVDTPAGPGWEDHAELAAPGLAQLQSIDRAGRHWLIDRPDTNGV
WLWPDGDATRATALGSADSTIIQRLSADGRWAALLTTLPATEARLYALPGGERQAALPVS
GATLAEFSPDGEWLVLGTAEGFSIHRTSAPTQPAHQFKCPVPGALYGYSTFSPDGRRFAY
MHELSAVAFAQPGEWQPDLILTLPHEVQRTAWAWAPDGETLYILSGRNEGYALRPAAAAA
ALDQLGFTPPTP
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atggccacctgccccacctgctcgctccactacgatgccgccgccaccggcgggccttgc
ccgcgctgtgcgctggccggggcgctcaccgccgccaatccggccgggaccgcagactac
gagttcttgggcgagctgggccgcggcggcatgggcgtggtctcgctggtccgccagcgc
agcctcgaccgcctcgtggctctcaaggtcatcgccgccaccggcgatgccaccggcccc
gcccgcctgctgcgcgaggcccgcgccgccgccgccatcactcacccccacgtcgtggcc
gtgcacgaggtcggtcagggcgagtcaggcgcctttatcgccatggaatattgcgagggg
ggcgacctgcgcgcccggctcaagcagggtccgctcgccccgcgcgccgccgccaccctg
ggcctcaagctcgcggccgccgtcgcccgggcccacgccctcggcgtcctccaccgcgac
ctcaagccctcgaacgtgctgctcaccggcaccggcgaacccaagctctgcgacttcggc
ctcagcggctccgtcgctggcaccgcctcggagcacacccgcaccgggatcctggccggc
tcgccctcctacctcgccccggaagtgctgtctggtgccgatcccacccccgccctcgac
ctctacggcctcggggcgatcctctatgaatccgtgaccggccggccgcctttcaccggc
gactcgcccgccgccgtcctcgcccaaatcggcaccaccgagccggtggccccgcgtcgg
ctgagccccgccgtgccggccgacctcgagaccatcatcctcacctgcctcgcgaaggac
cccgccgcccgctacgccagcgcccacgccctgtgggcggacttggaaaatttcctcgcc
ggccggcccatccacgcccggccgccctcgcccgccggccgcctcgggcgctgggcgcgg
cgcaaccccgccctggccgccgccctcgccatcatcgccaccgggaccgtcgccgcgacc
acgctgctcgtcgagcgcaaccaccagctccacgcggcgctcgcccgctcggaaatcgcc
gaggccgatgcccgcctcgccctccgcgactcgcttttcgcccaagcccggggcgtccgc
caaagcggccgcaccggtcagcgtcatgaagctctccgcctgctccgcgcttccgccgcg
ctcgccggacccaccgccgcgatccgcgcggaggcgctggccgccctggcactcgatgac
tggcagtgggggaaaccccaggccgtgccgcacctgcgtttcagccagctggttggcttc
gactcggccctggagcacgccgccgtgcccgccgcagacggcacgaccatcgaggtccgg
cgcatgcgcgacggtcaggtgctgcgccacctgcaaaccgcctccgccagccgcgtccgt
gaaacccgttacgccccctccgatgcctggatcctcgccgaatccgaggacggcacccag
gctgtctgggctgccggcgcaacggtgccgcactggatccaccagcccgccgggatccaa
tacgtgggactcgatttcgcctccgacgacagcggctggtggtacaccactaccggcaac
cagctcatgtggtgcgacgcccgcaccgggaccgggcatccggtcggcgacccgggcacc
accatctacggcatcaaaccctcgcccgatggcacccggctcgccgtgctgcgcgatgat
ggcttggagctgtggcagctgcgcgatcggcagctgctctggcggatcgacggcgacgtc
ggctcggcggccccggcctggacgccagacggccaccatctgatcacggaagcttacaac
ggctcgccccagatcgcggtctgggacgcagccgacaagcggcaggtcctgaccctgcgg
ccgggcaacatgcgggccagccgcttcgccatgctgccggatggccggcggctgctgtcg
ctggatacggattcggtcctgcgactctgggacatcaccgccggccgcgaattgctgcgc
gggcaggccggcccccacggcctgcggctcagcgccgatgggcggcaggccgccggatcc
tcctcattccaacagcttgcccgcctggatctggcccccctcgacgtcgtacaacccctg
gggtttgccctgggccaaaactctggcctctggcggcaagccgccgtcagccccgatgga
cgctggctcgtcggacaaagcaccaccttccttcgcgcctacgatctgccgcagcatcgg
gaaacggcgcgataccggtatgccgccggcaagaccaaggccctggccttcctgcccgat
ggcgggctgctctacagttcgcccacccttggcatccgccgcacccggctggtggacacc
cccgccgggccggggtgggaggatcacgcggaactcgccgcgcccggcctcgcccagctg
cagtctatcgaccgcgcgggccggcactggctcatcgaccggccggataccaacggcgta
tggctctggccagacggtgatgccacccgcgcgaccgccctcggttccgccgattccacc
atcatccaacgcctcagcgcggatggccgctgggccgccctgctgacgaccctccccgca
accgaagcccggctgtatgccctgcccggcggcgaacggcaggccgccctgccggtcagc
ggcgccacgctggcggagttttcccccgacggcgaatggctcgtgctgggcaccgccgag
gggttttcgatccaccgcacaagtgccccgacccaacccgcgcatcagttcaaatgcccg
gtgcccggcgccctctatggctacagcacgttttcgcccgatggccgccgcttcgcttac
atgcacgagttgagcgccgtggctttcgctcagcccggcgaatggcagccggatctcatt
ctcaccctgcctcacgaggtccagcgcacggcctgggcctgggcgcccgatggcgagacc
ctgtatattctatccggccgcaacgagggctacgcactgcgccccgccgccgccgccgcc
gcgctcgaccagctcggcttcacgccgcctaccccctga

DBGET integrated database retrieval system