KEGG   Lacunisphaera limnophila: Verru16b_02675Help
Entry
Verru16b_02675    CDS       T04567                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
obg  Lacunisphaera limnophila
Pathway
obg00620  Pyruvate metabolism
obg00680  Methane metabolism
obg01100  Metabolic pathways
obg01120  Microbial metabolism in diverse environments
obg01200  Carbon metabolism
Module
obg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:obg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Verru16b_02675 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    Verru16b_02675 (ppc)
Enzymes [BR:obg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Verru16b_02675 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOS45592
UniProt: A0A1D8AXH7
LinkDB All DBs
Position
3157220..3159970
Genome map
AA seq 916 aa AA seqDB search
MPAPTHALDQHAKLRAEIRSLGATLGQTIATLEGPRTLEMVEALRTLAKSSRAGDHAAAQ
ELAHTIGRLTPADAFNQAMAFTLYFELVNLAEENFRIRLLRERNLRHRGALAAGHASEPL
RESIEAAVIELKQAGVSAQKMQKLVRQLSIELVFTAHPTESKRRTMLEKLATLAGMLRSH
TFEEIQHAPDDVRREIVSLWLTDRSRTERPMVEDEARTGLWYFDRTLYRLLPRLHADLQE
ALNRHYPGVRAPNRWLSFGSWIGGDRDGNPGVTAGVTAEVLRMNRRMAVRKLADVLYRLA
GSLTVSDRRARFAPIIRRMADECRSSSAMMSRVGSRYPREPYRIILSSLRERLLAQAEAG
ALAEDSSGDAQETTATVRGILAQIEADLLRDRAAPLACGELRDAITCVDVFGLSTARLDL
RQHSGPHARAVAELLQRPDYEQLAEPDKQALLTAALKGAVALTTDRVAALSPETRTVIEP
LCLALRAQQHYGPDALGIYIISMTNEVSDVLEALWLQRLAGAHLPIAPLFETLDDLSRAP
AILTALFTHPAYAAEVARNNRHQHVMLGYSDSNKDCGYLTANWALFQAQDAIMRVCRQHR
MRVTLFHGRGGSIARGGGPAAKAILAQPVGLKDGGIRVTEQGEVLSTRYHDPDLAHRVLE
QMAYGVLLGANEAQQGSRRVPKRWAQAMEQMSAAALAAYRACVHEDPDFLTFWRQATPID
EISELNFGSRPTYRRKGSISVGDLRAIPWVFSWMQSRFNFPGWYGLGSGLHAVLGRKGGP
KLLREMYQRWPFFQTMVDNAQLTVCKADMSIAKVYASLVEDARLRENVFNRLAGEFRLTE
EMILAVTGQAHLLENEPVLAKSIKLRNPYVDPLNYLQVEMIKRRRVRRLNKPDREGIRAV
MELTVNGIAGGLKNTG
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgccggctcccacgcacgccctggatcaacatgccaagctacgggccgagatcagaagt
ctcggcgcgacgctgggtcagaccattgccacccttgaaggcccccgcaccctggaaatg
gtcgaggccctgcgcacgctggcgaaaagcagccgcgcgggggaccatgccgccgcgcag
gaactggcccacaccatcgggcggctgacgccggcggacgccttcaaccaggccatggcc
ttcacgctctactttgaactggtcaacctggctgaggaaaatttccgcatccgcctgctg
cgcgagcgcaacctgcgccaccgcggcgccctcgcggcgggccacgccagcgagcccctg
cgcgagtcgatcgaggccgccgtcatcgagctgaagcaggccggggtctccgcccagaag
atgcagaaactcgtgcgccagctctccatcgagctcgtgttcaccgcccatcccaccgag
tccaagcgccgcaccatgctggagaagctggccacgctggcgggcatgttgcgcagccac
accttcgaggaaatccagcatgcgccggacgacgtccgccgggaaattgtctccctctgg
ctcaccgaccgcagccgcaccgagcggccgatggtggaggacgaggcccggaccggcctg
tggtactttgaccgcaccctctaccggctgctgccgcgcctccacgccgacctgcaggag
gcgctcaaccgccattatccgggcgtgcgggcgcccaaccgctggctttccttcggctcg
tggatcggcggcgatcgcgacggcaatcccggggtgacagcgggggtgacggccgaggtc
ctgcggatgaaccggcggatggcggtccggaagctggccgatgtgctttaccgcttggcg
ggctcgctgacggtttcggatcgccgggcgcgtttcgcccccatcatccgccgcatggcc
gacgaatgccggtcctcctccgcgatgatgtcccgggtgggctcacggtacccgcgcgag
ccgtatcgcatcattctgagcagcctccgggaacggctcctggcgcaggcggaggccggg
gccttggcagaggactcctccggtgacgctcaggaaacgaccgccaccgtgcgtggcatc
cttgcgcagatcgaggctgacctcttgcgggaccgggccgcgccgctggcctgtggtgaa
ctgcgcgatgcgatcacctgcgtggatgtttttggcctgagcaccgcgcgcctcgacctg
cggcagcactcgggaccgcacgcccgtgcggtggcggaactgctgcagcgtcccgattac
gagcagttggcggagccggacaaacaggccctgctgaccgcggccctgaagggtgccgtg
gcgctcacgaccgaccgggtggccgccctgagcccggagacccgcaccgtcatcgagccg
ctctgcctggcgttacgagcccagcagcattacgggcccgacgccctcggcatctacatc
atcagcatgaccaacgaggtgtcagacgtgctggaagccctgtggctgcagcggctggcg
ggcgcgcacctgcccattgcgccgttgttcgagacgctcgacgatctcagtcgcgccccg
gcgatcctgaccgccctgttcacgcacccggcctacgccgccgaggtggcccggaacaac
cggcaccagcacgtcatgctgggctattccgactcgaacaaggattgcggctacctgacg
gccaactgggcgctgttccaggcccaggatgcgatcatgcgcgtctgccggcagcaccgg
atgcgggtcacgctcttccacggacgcggcggcagcatcgcccgaggcggcggtcccgcg
gccaaggcgatcctggcgcaaccggtggggcttaaggacggtggcatccgcgtcacggag
cagggtgaagtgctttcgacccgctaccacgacccggacctggcgcaccgggtgttggag
cagatggcctacggcgttttgctgggcgcgaacgaggcgcagcagggttcgcggcgcgta
cccaagcgctgggcccaggcgatggagcagatgagtgcggccgcgctcgcggcctaccgg
gcctgcgtgcacgaggatccggatttcctgaccttctggcggcaagccacgccgatcgat
gagatcagcgagctcaacttcggatcgcgtcccacctaccgccgcaagggcagcatcagc
gtgggcgacctgcgcgccatcccctgggtgttctcgtggatgcagagtcgtttcaatttc
ccgggctggtatggcttgggcagcggcttgcacgccgtgctcggccgcaagggaggcccc
aagctgctgcgcgaaatgtatcaacgctggcccttcttccagacgatggtggacaacgcg
cagctgaccgtctgcaaggccgacatgtccatcgccaaggtctacgcctcgctggtcgag
gacgcgcgcctgcgcgagaacgtgttcaatcgcttggccggggagttccgtctgaccgag
gagatgatcctcgcggtgacggggcaggcccacctgctggagaacgagccggtgctcgcg
aagtcgatcaagctgcgcaatccctacgtggacccgctcaactacctgcaggtggagatg
atcaagcgccgccgcgtgcgccgcctgaacaagccggaccgggagggtatccgcgccgtg
atggagctgacggtcaacggcatcgcgggcgggttgaagaatacggggtaa

DBGET integrated database retrieval system