KEGG   Lacunisphaera limnophila: Verru16b_02762Help
Entry
Verru16b_02762    CDS       T04567                                 

Gene name
lacZ_5
Definition
(GenBank) Beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
obg  Lacunisphaera limnophila
Pathway
obg00052  Galactose metabolism
obg00511  Other glycan degradation
obg00600  Sphingolipid metabolism
obg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Verru16b_02762 (lacZ_5)
  Lipid metabolism
   00600 Sphingolipid metabolism
    Verru16b_02762 (lacZ_5)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Verru16b_02762 (lacZ_5)
Enzymes [BR:obg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Verru16b_02762 (lacZ_5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AOS45677
UniProt: A0A1D8AXS4
LinkDB All DBs
Position
complement(3265538..3268162)
Genome map
AA seq 874 aa AA seqDB search
MRLLLLAATLLISLPVSVLAAEAPPRERLSFNEGWLFSRTDAEWVLGQLDYANAKPWLLA
SAADFFGPTSPQTARPRGNFGGGFTHVQADFDDRGWRPLTLPHDWGIEGPFKQEYPGDTG
KLPWWGVAWYRKHFDLPATDAGRRIVLEIDGAMAHSLVWLNGQFVGGWPYGYSSYQLDLT
PYIKPGQPNVLAIRLDNPTESSRWYPGSGLYRNVWLTKTNPVHVAPWGAIVTTPKVTAEA
AQVSIQVLTDNDSATNAALSLSTELFALDDTGRKSAALGQPITVTIEPGRQASTTQTLRV
PQPRLWSVTHPHRYVAVTSITQDGRLVDRLETPFGIRTAVFDADRGFRLNGEVVPIRGVC
NHHDLGALGSAINLRALERQLEILRAMGCNAIRTSHNPPAPELLDLCDRMGFLVMDEAFD
CWAKGKNRHDYHVQFPDWHEADLRALVRRDRNHPSVILWSIGNEVIEQWFADGQEGWKLA
ARLAGIVREEDRTRPVSAGFNGEISGYNGYQHVLDAIGYNYRIKEYARFREINPAIPLFG
AETASALSSRGVYFFPISDDKIDPASRADFQVSSYDLYAAPWATPPDVEWRAADAVPGYA
GEFVWTGFDYLGEPTPYNADLTNLLNFSDPAEKERQKQLLTELGRIPTPSRSSYFGIIDL
AGFPKDRYYFYQARWRPDLPMAHLLPHWTWPERAGEITPIHAYTSGDEAELFLNGRSLGR
KQRGPGEYRLRWDDVKYAPGEVKVVAYKQGAVWAEAVQRTAGPAARLKAKADRRELTADG
RDLSFVTVRIEDADGVLAPRAENRVAFAVSGPAEIVATDNGDPTSFESFQSKERAAFNGL
VLVVVRTQPGTTGPITLTATSPGLAPAEVSLTAK
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgctcctgcttgccgccaccctgctcatctccttgccggtctccgtcctcgcc
gccgaagccccgccccgggagcgcctctccttcaatgagggctggctcttcagccgcacc
gacgccgaatgggtgctcggccagctcgactacgccaacgccaagccctggttgctggcc
tcggccgccgactttttcggccccaccagtccgcaaaccgcgcgcccgcgcggcaatttc
ggcgggggcttcacccacgtgcaggccgacttcgatgaccgcggctggcgcccgctgacg
ctgccccatgactggggcatcgagggtcccttcaagcaggaataccccggcgataccggc
aaactcccgtggtggggcgtcgcctggtaccgcaagcactttgacctgcccgccaccgat
gccggccgccgcatcgtcctcgaaatcgacggcgcgatggcccactccctcgtctggctc
aacggccagttcgtcggcggctggccctacggctattcttcctaccagctcgacctgacc
ccctacatcaagcccggccagccgaacgtcctcgccatccgcctcgacaacccgacggaa
tcctcgcgctggtacccgggcagcggcctctaccgcaatgtgtggctcaccaagaccaac
ccggtccacgtcgccccctggggtgccatcgtcaccacacccaaggtcacggccgaagcc
gcgcaggtcagcatccaggtccttacggacaacgactcggccaccaacgccgcgctcagc
ctcagcaccgagctcttcgccctcgacgacacgggccgcaaatccgccgccctcggccag
cccatcacggtcaccatcgagcccggccgccaggcctcgaccacccagaccctccgcgtg
ccacaaccccggctctggagcgtgacccacccccaccgctacgtcgccgtgaccagcatc
acgcaggacggccggctcgtcgatcgcctcgagacgcctttcggcatccgcaccgcggtc
tttgacgccgatcgtggcttccgcctcaacggcgaggtcgtgccgatccgcggcgtgtgc
aaccaccacgacctcggcgccctgggctccgccatcaacctccgcgccctcgagcgccag
ctcgagatcctccgcgcgatgggctgcaacgccatccgcaccagccacaacccgcccgcg
cccgagctgctcgatctctgcgaccgcatgggcttcctcgtcatggacgaagccttcgac
tgctgggccaagggcaagaaccggcatgattaccacgtgcagttccccgactggcacgag
gccgacctgcgtgccctcgtccggcgcgaccgcaaccaccccagcgtcatcctgtggagc
atcggcaacgaggtcatcgagcaatggtttgccgacggccaggagggctggaaactggcc
gcccggctcgccggcatcgtccgcgaggaggaccgcacccgcccggtcagcgccggtttc
aacggcgagatcagcggctacaacggctaccagcacgtgctcgacgccataggctacaac
taccgcatcaaggagtacgcccgcttccgggagatcaaccccgccatcccgctcttcggg
gccgagaccgcctccgccctcagctcgcgcggggtgtactttttcccgatcagcgacgac
aagatcgatcccgccagccgcgccgacttccaggtcagcagctacgatctctacgccgcc
ccgtgggccaccccgcctgacgtggagtggcgcgccgccgacgccgtgcccggctacgcc
ggcgagttcgtctggaccggcttcgactacctcggcgagcccacgccctacaacgccgac
ctcaccaacctgctcaacttctccgatcccgccgagaaggagcgccagaagcagcttctc
accgaactcggccggatccccacgccatcccgcagctcctacttcggcatcatcgacctg
gccggcttccccaaggaccgctactatttctaccaggcccgctggcgccccgacctgccc
atggcccatctcctcccgcactggacctggcccgaacgcgccggcgaaatcacgcccatc
catgcctacacctccggcgacgaggccgaactgttcctcaacggccggtccctgggccgc
aagcaacgcggtccgggcgaataccgcctgcgctgggacgacgtgaaatacgcgcccggc
gaggtgaaggtggtcgcctacaagcagggcgccgtctgggccgaagcggtccaacgcacc
gccggaccggccgcgcgtctcaaggcgaaggccgaccgtcgcgaactcacggctgacggc
cgggatctctcattcgtcaccgtgcggatcgaggacgccgacggcgtgctcgcgccccgc
gctgagaatcgcgtggccttcgccgtcagcggcccggccgagatcgtcgccaccgacaac
ggcgatcccacgagcttcgaatccttccagtccaaggagcgcgccgccttcaacggcctc
gtgctggtggtcgtccgtacccagccgggcaccaccggcccgatcaccctcaccgccacc
tcccccggcttggcccctgccgaagtcagcctgaccgccaagtaa

DBGET integrated database retrieval system