KEGG   Octopus bimaculoides: 106867431Help
Entry
106867431         CDS       T04127                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
obi  Octopus bimaculoides
Pathway
obi03030  DNA replication
obi03410  Base excision repair
obi03420  Nucleotide excision repair
obi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:obi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106867431
   03410 Base excision repair
    106867431
   03420 Nucleotide excision repair
    106867431
   03430 Mismatch repair
    106867431
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:obi03032]
    106867431
   03400 DNA repair and recombination proteins [BR:obi03400]
    106867431
Enzymes [BR:obi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106867431
    6.5.1.6  DNA ligase (ATP or NAD+)
     106867431
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106867431
DNA replication proteins [BR:obi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106867431
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106867431
DNA repair and recombination proteins [BR:obi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106867431
   NER (nucleotide excision repair)
    Other NER factors
     106867431
   MMR (mismatch excision repair)
    Other MMR factors
     106867431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 106867431
NCBI-ProteinID: XP_014767792
LinkDB All DBs
Position
Un
AA seq 997 aa AA seqDB search
MQAFITSYFNASQNTLRASDTDSSKTSNADKSKEKKDSKREVKKEQRKVNNCSDSPIQKK
KRRTKCIIESDEEEAGDGSGNESPKKEDAVDNNGDVYDNDKGKSSDSGDDDDDDDDDDKS
ESETAETKGLKEKPKKSNKDNKIKTEDSSSPESSPSPKETSSETSPSAKAGTSIDSTTIT
PKKSPFGIPKRKTARKTVGPNSTPKRKIIGEESSSSCNGTSKRQKVEPLEEDVDSTSSDP
KKNQENLTTDKDKKKKKSEEKQSQQDTNESSVKKEVKKSKDSPEVKVASIFGNIKSKKTP
SKPESEKKKEPAKSTKSTTEIKEEKSEDVQCNGEVKPVEDKKYNPADSKYDPIKSACWAP
KAKVPYLALAKTFEEIESVSARLKMIEILSNFFRSVILLSPDDLLCCVYLCLNKLAPAYE
GIELGIGEMVLMKAIAQATGRSVDKIKNDVQEKGDLGLVAESSRSNQRTMFAPPKLTIAG
VFSKLKEIALMTGNSVMSKKIDKIKVMFVACRSSEARFLIRSLGGKLRIGLAEQSVLTAL
GSAIFLSPPGQAYPPVIVNAGKNVSADSLKKKVEESVLAIKTTYCECPNYDAIIKVLLSD
GIDELPNKCKLTPGIPLKPMLANPTKGISDVLAKFDVAEFTCEYKYDGERAQIHMKEDGK
VEIYSRNSEDNTTKYPDVIQRISKSVGKDVKSFVLDSEAVAWDKENQSILPFQVLSTRKK
KDASADDIKVQVCIHAFDLLYLNGESLVREPFRKRRQLLWDNFIEVEGEFVFAKSLTASD
HEVIGEFLEESIKGNCEGLIVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVAIG
GYLGTGKRTGRYGGFLLACYDDENEEFQTICKLGTGFKDEDLEKHTNFFKDHLIETAKPY
YRWDSSMKPDHWFESVQVWEVKAADLSISPVHKAASGQVDSEKGISLRFPRFLRIRDDKK
PEEATSATQVANMYRNQEQVKNTQAKSDPKATDDDFY
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgtttattacgtcctattttaacgcatcacaaaacactctacgtgcatctgat
actgacagcagtaaaacaagcaatgcagataaatctaaagaaaaaaaagattccaagagg
gaagttaaaaaagaacagcgaaaagtaaacaactgctcagacagtcctatccagaaaaag
aagagaagaactaagtgtattatagagagcgatgaagaagaagctggtgatggcagtgga
aacgaatctcctaagaaagaagatgctgtggacaataatggtgatgtttatgacaatgat
aaaggaaaatcttctgatagtggtgatgacgatgatgatgatgatgatgatgataagtca
gaatctgaaacagcagagaccaaaggactgaaagaaaagcctaaaaagtctaataaagat
aacaaaatcaaaacagaagactctagttctccagaaagttcaccgtcaccaaaggagaca
tcatcggagactagcccttctgctaaggctggtactagtattgattctacaaccatcaca
ccaaaaaaatctccatttggtattcctaaaagaaaaacagctcggaaaacagttggacct
aattctactccaaaacgtaaaattattggagaagagtcatcaagttcttgtaatggaact
tccaagcgacaaaaagttgagccattagaagaggatgtggattccacatccagtgatcca
aagaagaaccaagaaaatttgacaacagacaaagataaaaaaaaaaaaaaatctgaagaa
aagcaatcccaacaagacacaaatgaatcttcagtgaaaaaagaagttaagaagtctaaa
gattctcctgaagtgaaagttgcctctatatttggtaacatcaaatcaaagaaaacacct
tcaaaaccagaatctgaaaaaaagaaggagcctgctaaatcaacgaaatcaaccacagaa
ataaaggaagaaaaatctgaagatgtacagtgcaatggtgaagtgaaacctgtagaggac
aagaaatacaatccagctgacagtaaatatgatcccatcaaatcagcctgttgggcccca
aaagcaaaggtcccttatttggctctggcaaaaacatttgaagaaattgaaagtgtatct
gcaaggttaaaaatgattgaaatattgtctaacttttttcgttccgtaatattactgtca
cctgatgacctgctctgttgtgtgtatctttgtctgaacaaattggctccagcctatgaa
ggaattgaacttggtattggggagatggtcttgatgaaagcaatagcacaagccacagga
cgcagtgtggataaaataaagaatgacgtccaggagaaaggagaccttggactggttgcg
gagtcaagtcgtagtaatcaacggaccatgtttgctccaccaaaactgactattgctggt
gtcttctctaaactgaaagagattgccctcatgactggaaactcagtaatgtcaaagaaa
attgacaagattaaagtcatgtttgtggcatgtcgttcatcagaggctcggtttctcata
aggtcccttggtgggaaactgcgtattggcctagctgaacaatctgttctaacagctttg
ggtagtgctatatttttatctcctcctggtcaagcttacccacctgtgattgtcaacgct
gggaaaaatgtgtcagctgatagcctgaagaagaaggtagaagagtcagtccttgccatt
aaaacaacatattgcgaatgtccaaattatgatgctataattaaggttcttctctcggat
ggtattgatgaactaccaaataagtgtaaattgactccaggaattcctctaaaacctatg
ttagcaaaccccacaaaaggtatcagtgatgtgttggcaaaatttgatgtggctgaattt
acctgtgaatataaatatgatggagaaagagctcagattcacatgaaggaagatggtaaa
gttgagatctacagccgcaattcagaagacaatactaccaaatatccagatgtcattcag
agaatatcaaagtctgttggcaaggatgtcaaatcttttgttcttgattcagaagctgtt
gcttgggataaagaaaaccaaagcattttaccatttcaagtcctgagtacacgtaagaaa
aaggatgcttccgctgatgatatcaaagttcaggtgtgtatccatgcatttgatttactt
tacctcaacggtgagtcactagttcgagaacctttccgcaagagacggcagttgctctgg
gacaattttattgaagtagaaggagaatttgtttttgccaaatctcttacagcatcagac
catgaagttattggagaatttttagaagaatcaataaaaggtaactgtgaaggcctaatt
gtcaaaactcttgatgttgatgccacttatgaaattgccaaaagatcacacaactggttg
aagctaaagaaagactaccttgatggtgttggtgatactttagatttagtggccattgga
ggctatttgggcactggaaaacgaactggacgctatggtggcttcttattagcctgttat
gatgatgaaaatgaagaatttcaaactatttgcaagttgggtactggtttcaaagatgaa
gacctggagaagcatacaaatttctttaaagatcatctgatagaaacagcaaagccctat
tacagatgggattctagcatgaaacctgatcattggtttgaatcagttcaagtgtgggaa
gtaaaagctgctgatttgtcaatttctccggtccacaaagcagcttctggtcaggttgat
tctgagaaaggtatttcacttcggtttccacgatttcttcgaatccgagatgacaaaaaa
ccagaagaagctacatctgcaactcaggtggctaacatgtatcggaaccaggagcaagtg
aaaaacacacaagccaaaagtgacccaaaagcaacagatgatgatttctattga

DBGET integrated database retrieval system