KEGG   Octopus bimaculoides: 106873500Help
Entry
106873500         CDS       T04127                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
obi  Octopus bimaculoides
Pathway
obi00052  Galactose metabolism
obi00500  Starch and sucrose metabolism
obi01100  Metabolic pathways
obi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106873500
   00500 Starch and sucrose metabolism
    106873500
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106873500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:obi04147]
    106873500
Enzymes [BR:obi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106873500
Exosome [BR:obi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106873500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 106873500
NCBI-ProteinID: XP_014776372
LinkDB All DBs
Position
Un
AA seq 859 aa AA seqDB search
MFQVFAYITCFFTFTTFFIYWPLYYFSDCCFQPTDHRDSYCSIATNDRFDCHPELGASEK
SCKERGCCWDEMSEFACFYPPNFVGYIFNKSAVTKTGYSYRLSRSKPSPFPKDIAEIQMD
VYFETKTRLHIKIYDPHHKRYEIPFEVPKVNKRAQHVRYSFKTADIGKPFQFNVSRFNPS
TETVGTTLLETKGSLIFADQFLQLSYQLPSKYIYGLGEHHLPLLLPLENQKLAFWNKDHV
PEDALNLYGSHPFYLVLEEDGTSHGVYLHNSNAMDVILHPIPALTWRTIGGVLDMYVFLG
PKPNDVIQQYTEVIGRPFMPPYWSLGFHLCRYGYPTAKRTLEVMNRVRKAGIPQDIQWND
IDYMYKKRDFSFDLQNFGNQSALVEEIHSRGMKYIILIDPGIYAGISEKPYIPFKLGKKM
DIFIKDSTGKENLIGKDMNEISNFVTGSINGCPKHSPYENPPYLPAVRGKALKFATLCAS
AQQYLSSQYNLHNLYGITETKVSYSAMVNIRKKRPFLISRSTFSGSGRYGGHWTGDNLAT
YQDMASSVTDIINFNLFGIPMVGADICGFNKETTKELCQRWYQLGAFYPFSRSHNSIKLK
DQDPAAFGKAFSESTKKAYMTRYSLLPYLYTLFYKSHATGSAVARPLFYDFSNDKATYAL
DTQFFWGSSLLISPVLQSGVQKVLAYFPQGKWYNFYTGEYLIGVSHSFFLLNAPMDVINV
HLRGGAIIPLQEPALTTTISRKNPFTLLFALNASGKAFGELYWDDGESLNSVPNGVYNMI
HFFANKTSLYNSVIKAAYLKEQMTLRNVTIFGIPSQPTSVRFNRFSVPFSFQPHTKVLYV
PRLNSNLLVPFQLTWSFAH
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgttccaggttttcgcttatattacgtgtttctttacattcaccacattcttcatttat
tggccgctctattatttctcagactgctgtttccaaccaactgatcatcgagactcgtat
tgcagcatcgctaccaatgaccgttttgactgccatccagagttgggtgcctcagagaaa
tcctgcaaggaaagaggatgttgttgggatgagatgtcagaatttgcatgtttctatccc
ccaaattttgtgggttatatcttcaacaaatctgccgtcacaaagacaggatattcttac
aggctgagtcgtagcaaaccttcaccatttcccaaagatattgcagagatccaaatggat
gtttattttgaaacaaagacaagactacatatcaaaatatatgaccctcaccacaaacgc
tatgaaataccattcgaagtaccaaaagttaacaagcgggctcaacatgtcagatattct
ttcaagacagctgatatcggcaaacctttccagtttaatgtttctcggttcaatcccagc
acagaaaccgtcggaacaactctattagaaactaaaggttctctgatatttgctgaccaa
ttccttcagctgtcttaccagttaccttccaaatacatttatggtcttggagaacatcac
cttccactcttattaccattggaaaaccaaaaactagcattttggaataaagatcatgtc
cctgaggatgctttgaatttgtatggctcccatccattctatctggttcttgaagaggat
ggaaccagccatggcgtttaccttcacaacagcaatgccatggatgtcatcttgcaccca
atcccagcccttacgtggcgcactatcggaggcgtgttagatatgtatgtcttcctggga
ccgaaacccaatgatgtcatccagcaatataccgaagtgattggaagaccatttatgccg
ccatactggagccttggcttccatctctgcagatatggttatccgacagcaaagagaacc
ttggaagtgatgaaccgtgtcagaaaagctgggattcctcaggacatccaatggaatgac
attgattacatgtacaagaaaagggatttcagttttgatcttcagaattttggtaaccaa
tcggcgttggttgaagagattcacagtcggggaatgaaatacatcattctaattgatcct
ggaatctatgctggaatatcagaaaagccatacattcctttcaagcttggtaagaagatg
gatatctttatcaaagacagcaccggcaaggagaatcttattggtaaggatatgaatgaa
atatcaaactttgtgactggatcaataaatggttgccccaaacattcaccatatgaaaat
ccaccgtatttaccagctgttcgtggaaaggcactcaagtttgcaacactctgtgcatct
gcccaacaatatctctcctcacaatacaatttacataacctctatggaatcacagagact
aaagtaagctacagcgccatggttaatattagaaagaaacgaccattcttgatctcccgc
tcaacgttttctggcagtggtcgttatggtggacactggacaggagataatttggccaca
tatcaagacatggcttcctcagtaacagacatcatcaacttcaacttgtttggtattcca
atggttggggcagacatttgtggttttaataaagaaactaccaaagaactgtgtcaaaga
tggtatcagttgggtgcattctaccctttctctcgaagtcacaacagtatcaaactaaag
gaccaagatccagcagcatttggtaaggcattttctgaatcaacaaagaaggcttatatg
acacgatattctctactgccctacctttacaccctgttctacaaaagccatgcaactgga
tcagcagtggcacggcccctcttctacgatttctcgaacgataaagcaacatacgctttg
gatacacaatttttctggggttcttctttgttgatttctccagttcttcaatcgggtgta
cagaaggtattggcctatttccctcaaggtaaatggtacaatttttacacaggtgaatac
ctgatcggtgtctcacattcgtttttccttcttaatgctccaatggatgtgataaatgtt
catcttcgaggcggagctattatacccttgcaggaaccagctctaacgaccaccatcagc
cgtaaaaatcccttcacccttctgttcgctcttaatgccagtggcaaagcttttggtgaa
ctttattgggacgatggagagtctttgaattcagtacctaatggtgtatacaatatgata
cacttctttgccaacaaaacctccctctataattctgtcatcaaagctgcttacttaaaa
gaacagatgaccctccgtaacgtcacaatatttggtatacctagccaacccacgtcagtc
cggttcaacagattttctgtgcctttctctttccaacctcacaccaaggtgttgtatgta
ccaagactgaattctaatctgttggtcccctttcagttaacttggtcctttgcacattaa

DBGET integrated database retrieval system