KEGG   Octopus bimaculoides: 106875747Help
Entry
106875747         CDS       T04127                                 

Definition
(RefSeq) actin, adductor muscle-like
  KO
K05692  actin beta/gamma 1
Organism
obi  Octopus bimaculoides
Pathway
obi04145  Phagosome
Brite
KEGG Orthology (KO) [BR:obi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    106875747
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:obi03021]
    106875747
   03019 Messenger RNA biogenesis [BR:obi03019]
    106875747
   03036 Chromosome and associated proteins [BR:obi03036]
    106875747
   03029 Mitochondrial biogenesis [BR:obi03029]
    106875747
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:obi04812]
    106875747
   04147 Exosome [BR:obi04147]
    106875747
Transcription machinery [BR:obi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     106875747
Messenger RNA biogenesis [BR:obi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     106875747
Chromosome and associated proteins [BR:obi03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     106875747
    NuA4 complex
     106875747
  Chromatin remodeling factors
   BAF complex
    106875747
   PBAF complex
    106875747
   SWR1 complex
    106875747
Mitochondrial biogenesis [BR:obi03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    106875747
Cytoskeleton proteins [BR:obi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     106875747
Exosome [BR:obi04147]
 Exosomal proteins
  Proteins found in most exosomes
   106875747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin DUF5379
Motif
Other DBs
NCBI-GeneID: 106875747
NCBI-ProteinID: XP_014779484
UniProt: A0A0L8GN79
LinkDB All DBs
Position
Un
AA seq 376 aa AA seqDB search
MCNDDFAALVVDNGSGISKAGFAGNDSPSAVFSSIVGRPRHQSTMVGMAHKDFYVGNEAQ
NKRGILSLKYPIEHGIVTNWDDMEKIWEYTFYNELHVSPEDHPILLTESPLNPKVNREKM
TAIMFETFNAPAMYVAIQSVLSLYASGRTLGTVIDSGDGVTHTVPIYEGYGLPHAMHRLN
LAGHDLNDYLQMIITERGYSFTTSAEREIVRDVKEKLCYVAADFEEELVAAASFSSRENI
YELPDGQIITIGNERFRCPESLFQPSFLSMESDGIHEITYDSIMKCDVDIRKDLFANIVL
SGGTTMFPGIAERMHKEITSLALGNTKVKIVAPPARKYSAWIGGSILASFSSFQRMCIDK
EEYVDSGPSIVHRKCF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacgacgattttgccgctttggttgttgacaatggatcaggtatttccaaagct
ggatttgcaggaaatgattcgcctagtgctgtattttcctccatcgttggtagaccaaga
catcaaagtaccatggtcggtatggctcacaaagacttttacgttggaaacgaagcccag
aacaaaagaggcatcctttctttgaaataccccattgagcatggtattgttaccaactgg
gatgatatggagaaaatctgggaatataccttctacaatgagctccatgtttctcccgaa
gaccatcctattctcctcacagaatcccctcttaatcctaaagtcaacagagaaaagatg
acagcgatcatgttcgagaccttcaacgctcctgcaatgtatgttgcaattcaatctgtg
ttgtctctgtatgcttctggtcggaccctaggtactgttattgactcaggcgatggagtc
acgcacacggttcccatctatgaaggttatggccttccccatgctatgcaccgtttgaat
ttggctggccatgatcttaatgattacctccaaatgataattactgagcgtggttactca
ttcaccacatctgccgagagagaaattgttcgtgatgtcaaggagaaattatgttatgtt
gcagctgacttcgaagaggagctggttgctgctgcctctttctcttcccgtgaaaatatc
tacgaattacctgatggtcaaattatcaccattggtaatgaaaggtttaggtgtccagaa
tctctatttcaaccttcctttctgagtatggaatccgatggcatccatgagatcacatac
gattccattatgaaatgcgatgttgatatcaggaaagatttgttcgccaacattgtcttg
tctggaggtaccactatgtttccgggcattgccgaaagaatgcataaagaaatcacttcc
ttggctcttggaaacacgaaagtcaaaattgttgctcccccagcacgaaaatattccgcc
tggataggcggctctatcttagcttccttctcttctttccagcgaatgtgtattgacaag
gaagaatatgttgattctggaccgtctattgtccaccgcaaatgtttctag

DBGET integrated database retrieval system