KEGG   Octopus bimaculoides: 106876776Help
Entry
106876776         CDS       T04127                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
obi  Octopus bimaculoides
Pathway
obi00010  Glycolysis / Gluconeogenesis
obi00053  Ascorbate and aldarate metabolism
obi00071  Fatty acid degradation
obi00280  Valine, leucine and isoleucine degradation
obi00310  Lysine degradation
obi00330  Arginine and proline metabolism
obi00340  Histidine metabolism
obi00380  Tryptophan metabolism
obi00410  beta-Alanine metabolism
obi00561  Glycerolipid metabolism
obi00620  Pyruvate metabolism
obi01100  Metabolic pathways
Module
obi_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106876776
   00053 Ascorbate and aldarate metabolism
    106876776
   00620 Pyruvate metabolism
    106876776
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106876776
   00561 Glycerolipid metabolism
    106876776
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    106876776
   00310 Lysine degradation
    106876776
   00330 Arginine and proline metabolism
    106876776
   00340 Histidine metabolism
    106876776
   00380 Tryptophan metabolism
    106876776
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106876776
Enzymes [BR:obi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     106876776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 106876776
NCBI-ProteinID: XP_014780969
UniProt: A0A0L8GHP9
LinkDB All DBs
Position
Un
AA seq 521 aa AA seqDB search
MLSISTWRSISRCPLRWYMLSSKAGYAGIPAPITNPDIAQSKIFINNEFVNSVSGKTFQT
LNPANGDVICEVAEGDKADIDRAVAAAKDAFRLGSPWRRMDASDRGNLMYKLADLIERDK
NYIASLETLDNGKTYTQSFLVDVAAVINTYRYYAGWADKNHGKTIPIRGNHFTYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALALGNTVVMKTAEQTPLSALYIAQLAVEAGYPPGVLN
IVPGYGPTAGAALAKHMDVDKIAFTGSTEIGKIVSVMATESNLKRVTLELGGKSPNIVFA
DANMDLAVETCHLGLFFNQGQCCCAGSRIFVEEKIYDEFVARSVEQAKRKIVGDPFDPSS
DQGPQVDQEQLTKILSLIESGKEEGAKLCTGGARHGDKGYFLEPTVFADVQDNMRIAQEE
IFGPVMQIMKFRDMNELIERAHNTIYGLAAAVMTTDLDKALHISNSIRAGTVWVNCFDVL
DTAAPFGGYKMSGNGRELGEYGLENYTEVKTVTIKVPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctctcaatatcaacctggcgcagcatttcgcgttgtcctttacggtggtatatgcta
tcatccaaagctggttacgcggggataccagctcctataacgaaccctgacatcgctcag
tctaagatttttataaacaacgaatttgtgaattctgtcagtggcaaaacatttcaaact
ttgaacccagccaatggagatgttatttgtgaagttgctgaaggagataaggcagatatt
gacagggcagtggctgctgccaaagatgctttcagactggggtcaccatggagaagaatg
gatgcctcagaccgtggcaatttaatgtacaaactggcagatttaattgaaagagacaag
aattacattgcatctttagaaactcttgacaatggtaaaacctacacccagtctttcctt
gtcgatgttgctgctgtcattaatacttacagatattacgctggctgggctgacaaaaac
catgggaaaactattcctatccgtggaaaccacttcacctacacaagacatgaacctgtt
ggagtctgtggacaaattattccttggaacttccctttgctgatgcaagcatggaagctt
ggacctgccctggctctaggaaacacagttgtgatgaaaacagctgaacagacacccctc
agtgctctttatattgcacaacttgctgtagaggctggttatcctcctggcgttctgaat
attgtccctggctatgggccaacagctggagctgctcttgctaaacacatggatgttgat
aaaattgcctttactggttctactgaaattgggaaaattgtttcggtcatggccacagag
agtaatttaaagagagtaactttggaacttggtggtaaaagtccaaatatagtatttgct
gatgccaatatggaccttgctgtcgagacttgccatcttggtctgttcttcaaccaaggt
cagtgttgctgtgccggttccagaatatttgtggaggaaaagatctacgatgaatttgtt
gcacgcagtgttgagcaagcaaaacggaaaatagtcggagatcctttcgatccttcttct
gatcaaggtccacaggttgaccaggaacaactgacaaagatcctttcactgattgaaagt
ggtaaagaagaaggagcaaaactctgtaccggtggcgccagacatggtgataaagggtat
ttcttggagccaactgtatttgctgatgtacaagataacatgaggattgcccaagaggaa
atctttggtccagtaatgcagataatgaaattccgtgatatgaacgagttaattgagagg
gctcacaacaccatatatggtttggctgctgctgttatgacaacagatcttgacaaagct
cttcacatatcaaactcaatcagagcaggaactgtttgggtcaactgctttgatgttttg
gatactgctgcaccttttggtggttacaagatgtcaggaaatggacgagaacttggagaa
tatggacttgaaaattacactgaagtgaaaactgttaccattaaagtgcctcagaagaat
tcttaa

DBGET integrated database retrieval system