KEGG   Octopus bimaculoides: 106877278Help
Entry
106877278         CDS       T04127                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
obi  Octopus bimaculoides
Pathway
obi00052  Galactose metabolism
obi00500  Starch and sucrose metabolism
obi01100  Metabolic pathways
obi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106877278
   00500 Starch and sucrose metabolism
    106877278
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106877278
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:obi04147]
    106877278
Enzymes [BR:obi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106877278
Exosome [BR:obi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106877278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 DUF5110
Motif
Other DBs
NCBI-GeneID: 106877278
NCBI-ProteinID: XP_014781633
UniProt: A0A0L8GEY9
LinkDB All DBs
Position
Un
AA seq 350 aa AA seqDB search
VLRKLLKKRSLVISRSTYAGTGVYGGHWSGDNHAAWEDMYYSIPEMLNFQLFGMPMIGAD
ICGFLDPTTTELCVRWTQIGAFYPFMRNHNGWNFPAQDPAVFDARAQSAMRKVLLTRYSL
LPYLYTLLHYSHQDGSAVVWPLFFIEPNEETFKIDRQFLWGSDLMISPVLKPKTFSTKAY
FPKGLWYDFYTGNMISSAGLYMFLDAPWDKINLHVRGGAIIPTIEPDVTTTASRKKKFGL
FVAADSNSTSRGELFWDDGESFDTVKTGKYTHLVFTGAQNNVTSEVLASGYSPPTELYLG
HVLVCGVAKGPHQVLANSKPAKFIWFPNSQVLNITNMALSLTHPFTITWS
NT seq 1054 nt NT seq  +upstreamnt  +downstreamnt
ggttcttcggaagcttctcaagaaaagaagtctagtcatcagtcggtcaacatatgcagg
aactggtgtctacggtggacattggtctggtgacaatcatgccgcatgggaagacatgta
ctattcaataccagaaatgctaaacttccaattatttggtatgccaatgattggcgctga
catctgtggtttcttggatcccaccacaacagaactgtgcgtacgatggacccagattgg
agcattttacccttttatgaggaatcacaatggatggaattttccagcccaagacccagc
tgtattcgacgcccgtgctcaaagtgctatgaggaaggtattactaacacgctatagtct
actgccttatctctacacccttcttcactacagccatcaagatggctctgcagttgtttg
gcccttgttcttcatagaacccaatgaagagaccttcaagattgatcgacagtttttgtg
gggcagtgatctgatgatcagtccagtcctgaaaccaaaaacattcagtaccaaagccta
ctttcccaaaggtttatggtatgacttctacactggcaacatgattagttcagctggcct
ctacatgttcctcgatgctccatgggacaagattaacctacatgttcgtggaggtgcaat
cataccaaccattgaacctgatgtcactactacagcatcgagaaagaagaaatttggttt
atttgttgctgctgacagtaacagcacgtcgagaggggaacttttctgggacgatggaga
aagtttcgatacagtgaagactggaaaatacacacatttagtgttcacgggtgcacaaaa
caatgtcaccagtgaagtgttggcatctggttactctccaccgactgaactctatcttgg
acatgttttggtctgtggtgttgccaaagggccgcaccaagttcttgcaaactctaagcc
agcaaaattcatatggtttcctaattcacaggttttaaacatcaccaacatggctctcag
cctcactcatccattcactattacctggagctga

DBGET integrated database retrieval system