KEGG   Octopus bimaculoides: 106878013Help
Entry
106878013         CDS       T04127                                 

Definition
(RefSeq) hexokinase-2-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
obi  Octopus bimaculoides
Pathway
obi00010  Glycolysis / Gluconeogenesis
obi00051  Fructose and mannose metabolism
obi00052  Galactose metabolism
obi00500  Starch and sucrose metabolism
obi00520  Amino sugar and nucleotide sugar metabolism
obi01100  Metabolic pathways
obi01200  Carbon metabolism
Module
obi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
obi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106878013
   00051 Fructose and mannose metabolism
    106878013
   00052 Galactose metabolism
    106878013
   00500 Starch and sucrose metabolism
    106878013
   00520 Amino sugar and nucleotide sugar metabolism
    106878013
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106878013
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:obi04131]
    106878013
Enzymes [BR:obi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106878013
Membrane trafficking [BR:obi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106878013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 106878013
NCBI-ProteinID: XP_014782576
UniProt: A0A0L8GBA0
LinkDB All DBs
Position
Un
AA seq 474 aa AA seqDB search
METYSRTDSCGSQGRSKRPRSIETIVRPFKLNDMNYREIMHLMIEKFKEGLSAKTNPIAS
VKMFPTYVRSTPKGTEVGDFLALDLGGTNFRVLHIKLDGQDTKMESKIFLIPQKIMSGTG
AELFDHIADCIYKFVKEQQLLTHYLPLGFTFSFPCRQEGLDRAILTTWTKGFKCEGVEGE
NIVELLHAAIKRKGQLNIKCVAVINDTVGALMSCAHSDRMCSVGIILGTGTNACYIERLE
NVDIWNEDKNEPKQVIINTEWGAFGDDGCLDKILTDYDRQVDKHSINPGKQRFEKTISGM
YMGELVRLILEKLRRHKLIFNGVGSEELSTRGRFYTKYVSEIESDIDDSFKNTKQVFQDL
NLTNFMVEDCRIAQYVCSTISTRAAYLSAAGTAALIHKMGRSEVTVAVDGSLYRFHPHFH
DLMVEKIKALCPLTRFRLMLSHDGSGKGAAIVASCATQEGQNQNNNSALRAEVH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttatagtaggactgatagttgtggtagccaaggacgttccaagcgacctcga
agtattgaaactatagtgcggccattcaagcttaatgacatgaattaccgggaaataatg
catttgatgatcgagaagttcaaggagggtttgagtgctaagactaacccaatagcctct
gtgaaaatgtttccaacatatgttcgatcaactccgaaaggaacagaagttggagatttc
cttgctctggatttaggtggcacaaacttccgtgtacttcatatcaaacttgatggtcaa
gacactaaaatggaaagtaaaatatttctgattcctcagaagattatgtctggaactgga
gccgaactctttgatcacatagcagattgtatatataaatttgtcaaagagcagcagctg
ttgacacattatttacctttgggcttcacattttcatttccttgtcgacaagaaggtctt
gatagagcaattcttaccacttggacgaaaggatttaagtgtgaaggagtggagggagaa
aatattgtggaattattacatgctgcaataaaacggaaaggacaacttaatattaaatgt
gtggctgtgatcaacgatactgttggagccctgatgtcttgcgcccacagtgaccgaatg
tgttctgttggtattatattaggtacaggtactaatgcttgttatattgagagactggaa
aatgtcgacatttggaatgaagataaaaacgaaccaaaacaagttataattaacacagaa
tggggtgcatttggagatgatggctgtttggacaagattctaacagattacgacaggcag
gttgacaagcattccatcaacccaggaaagcaacgatttgagaagacaatatctggaatg
tacatgggggaacttgtccgtcttatacttgaaaagttacgcagacataaactgattttc
aatggcgttggctcagaagagttatcaactcgtggacggttttacacaaaatatgtttct
gaaattgaaagtgatattgatgatagcttcaaaaatactaaacaggtctttcaagatctt
aacttaacaaactttatggtggaagattgtcgtatcgctcagtatgtctgctcaactatt
tccacacgagctgcctatttatctgccgcaggtactgctgctttgattcacaagatgggt
cgatctgaagttactgttgctgtagatggctctctctacagattccatcctcattttcat
gacttaatggtagaaaaaattaaagcactttgtccccttactagatttcgtctgatgctg
tcccatgatggaagtggaaaaggtgcagcaatcgttgcaagttgtgctacacaagaaggc
cagaatcaaaacaacaattctgcattaagggcggaagttcattga

DBGET integrated database retrieval system