KEGG   Octopus bimaculoides: 106878224Help
Entry
106878224         CDS       T04127                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
obi  Octopus bimaculoides
Pathway
obi00480  Glutathione metabolism
obi00980  Metabolism of xenobiotics by cytochrome P450
obi00982  Drug metabolism - cytochrome P450
obi00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106878224
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106878224
   00982 Drug metabolism - cytochrome P450
    106878224
   00983 Drug metabolism - other enzymes
    106878224
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:obi02000]
    106878224
Enzymes [BR:obi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106878224
Transporters [BR:obi02000]
 Other Transporters
  Pores ion channels [TC:1]
   106878224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 106878224
NCBI-ProteinID: XP_014782862
UniProt: A0A0L8GAD8
LinkDB All DBs
Position
Un
AA seq 278 aa AA seqDB search
MFAQNQACLKSGLQFTAKEALRKLSTYASMVTEQAYTKGSKCPKLEPGTLRLYSMRFCPF
AERTRLVLQHKRIPHEIVNINLKHKPEWFLEKTPIGRVPVIEHDSKIIYESIICNEYLEK
IFPNPPLTPTDPYSQAKDQMLVSLMDKILKIFRKVAGRHKGDETDTLINKMVIQLHYFEE
ELKQRGGPFFGGKQVSMVDFNLWPWFEKIKAKVMTDQTIDQFITKEYPFLCQWNENMLQL
PEVKATRLNPQYYAAFIKSFASGDPDYDFGLQLNKSKL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgcaaaatcaagcttgtttaaagtccggcttgcagtttactgccaaggaagct
ctacgcaagttgtcaacatacgcaagcatggtaaccgagcaggcttatacaaaaggaagc
aaatgtcctaaactagagccaggtactttgcgcctctacagtatgaggttctgtcctttt
gctgaaagaaccagactggttttgcaacataaacgtattccgcatgagatagtgaacatc
aacctcaaacacaaaccagaatggttccttgaaaagactcctataggtcgagtacctgtc
attgaacatgattccaagattatctacgagtctataatctgcaatgaatatctagagaaa
atcttccccaatccaccattaactcccaccgacccctatagtcaggcaaaggatcagatg
ttagtcagccttatggacaagatattaaaaatctttaggaaggtagctggaagacataaa
ggtgatgaaaccgatactttgataaataagatggtaatccagcttcattattttgaagag
gaactcaaacaacgtggtggacccttctttggcgggaaacaagtcagtatggttgacttc
aatctttggccatggtttgagaaaattaaagcaaaagtaatgacagaccaaactatagac
cagttcatcaccaaagaatacccatttctatgccaatggaatgagaatatgttgcagctg
ccagaggtgaaggccacaagacttaatccccagtactatgctgcattcatcaaaagtttt
gccagtggagacccagattatgactttggtctccaactgaataaaagtaaattgtaa

DBGET integrated database retrieval system