KEGG   Octopus bimaculoides: 106881280Help
Entry
106881280         CDS       T04127                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
obi  Octopus bimaculoides
Pathway
obi00020  Citrate cycle (TCA cycle)
obi00190  Oxidative phosphorylation
obi01100  Metabolic pathways
obi01200  Carbon metabolism
Module
obi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
obi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
obi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106881280
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106881280
Enzymes [BR:obi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106881280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_18 Fer2 Fer4_7
Motif
Other DBs
NCBI-GeneID: 106881280
NCBI-ProteinID: XP_014787095
UniProt: A0A0L8FTB6
LinkDB All DBs
Position
Un
AA seq 292 aa AA seqDB search
MMAVPCSSLSRLLPISKALVPVLQSQSVRCAQTAAAVAAEPSKHVKTFTIYRWDPDKQGD
KPRMQSYEIDLNRCGPMVLDALIKIKNEDDPTLTFRRSCREGICGSCAMNIGGVNTLACI
CKIDGNLSKPTKIYPLPHMYVIKDLVPDMNNFYAQYASIEPYLKKKDIKEEDIGKEQYLQ
SVRDRAKLDGLYECILCACCSTSCPSYWWNSDKYLGPAVLMQAYRWMIDSRDDFTVERLS
KMEDKFSVYRCHTIMNCTKTCPKHLNPGLAIGEIKKMLALYKKNAETSAAHA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgtcccttgttcttctctctctcgacttttgcccatttcgaaagccttggtc
ccagttctacaatcccagtcagtgagatgtgcgcagactgcagctgcagtcgcagcggaa
ccaagcaagcatgtaaaaacttttactatttacagatgggatccagacaagcagggagat
aaaccacggatgcaaagctatgaaattgacttaaacagatgtgggcccatggtccttgat
gccttgatcaagataaagaatgaggatgaccccactttaacatttcggcggtcttgtcgt
gaaggcatctgtggctcttgtgccatgaatatcggtggtgtgaacaccttggcatgtatc
tgtaaaattgatggtaatttatcgaagcccaccaagatttaccctctacctcacatgtat
gtgattaaggaccttgtgcctgatatgaacaacttttatgcccagtatgcttctattgaa
ccatacttgaagaagaaagatattaaggaagaagatattggcaaggaacagtaccttcag
tctgtgcgggatagagcaaaattggatggtctttatgaatgtatattgtgtgcctgctgc
agtacctcctgccccagttactggtggaactctgacaaatatcttggtcctgcagtcctt
atgcaagcttatcgttggatgattgattctcgagatgattttactgttgaaaggctatcc
aaaatggaagacaagttctccgtctacaggtgtcacactatcatgaattgtaccaaaacc
tgtccaaaacatttgaatcctgggttggctattggagaaattaaaaagatgttggctctc
tataaaaagaatgctgaaactagtgcagctcatgcataa

DBGET integrated database retrieval system