KEGG   Octopus bimaculoides: 106882182Help
Entry
106882182         CDS       T04127                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit B, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
obi  Octopus bimaculoides
Pathway
obi00020  Citrate cycle (TCA cycle)
obi00190  Oxidative phosphorylation
obi01100  Metabolic pathways
obi01200  Carbon metabolism
Module
obi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
obi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
obi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106882182
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106882182
Enzymes [BR:obi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106882182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 106882182
NCBI-ProteinID: XP_014788253
UniProt: A0A0L8FPG4
LinkDB All DBs
Position
Un
AA seq 366 aa AA seqDB search
MRQVSFRLLDMALLLQFSAGTRNLLFKHLVKPSVASASQTRDFHFRIHGRNTDAKHSASA
QISRDYPVIDHTYDAVVVGAGGSGLRAAFGLANEGFKTACVTKLFPTRSHTVAAQGGINA
ALGNMEEDDWRYHFYDTVKGSDWLGDQDAISYMCEEAPKAVIELENYGMPFSRLENGKIY
QRAFGGQSLKYGKGGQAHRCCCVADRTGHSLLHTLYGRSLMYETQYFIEYFALDLIMEDG
ECRGVIALCLEDGSIHRIRAKNTVIATGGYGRTYFSCTSAHTCTGDGTAMVNRAGLCNED
LEFIQFHPTGIYGAGCLITEGCRGEGGYLINGEGERFMERYAPNAKDLASRDVVSRAMTI
EIREGR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaagtttcatttcgtttgcttgacatggcgttgttactgcagtttagtgctggg
acccgcaaccttttatttaaacatttggtgaaaccatccgtagcttcagcatctcaaact
cgtgatttccacttcagaatccatggccgtaacactgatgctaaacactctgcatcagcc
caaataagccgggactatccagtcattgatcacacatacgatgctgttgtcgtaggtgcc
ggtggctcaggattgagagcagcctttggtttggccaatgaaggtttcaaaacagcatgt
gtaaccaaactgtttccaactcgctcccacactgtggcagctcagggaggtatcaatgct
gctcttggtaacatggaagaggatgactggcgttaccatttctatgacacagtgaaagga
tcagattggcttggagatcaagatgctatcagctacatgtgtgaagaggcacccaaagct
gtcattgagctggaaaactatggtatgcctttcagtcgtttggaaaatggcaaaatatat
caacgtgcatttggtggtcagagtttgaaatatgggaaaggaggtcaagcacatcgctgt
tgttgtgttgctgacagaactggccattcattgctgcatactttatatggaaggtccctt
atgtatgagacacagtactttattgaatattttgcactggatttgattatggaagatggc
gagtgccgaggcgtgattgcactttgtctggaagatggttctattcatcgaatccgtgcc
aagaacacagtcattgcaaccggtggttatggaagaacttatttctcctgtacatcggcc
catacctgtactggggatggtactgcaatggtcaacagagctggtctgtgcaatgaagat
ttggagtttattcagtttcaccctactggtatttatggtgctggctgcctcatcactgaa
ggatgccgtggagaaggtggctatctgattaatggagaaggtgaacgttttatggaacgc
tatgctccaaatgccaaagatcttgcttctcgtgatgttgtatctcgtgccatgacaatt
gaaattcgtgaaggcaggtga

DBGET integrated database retrieval system