KEGG   Ooceraea biroi (clonal raider ant): 105275628
Entry
105275628         CDS       T05778                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo00230  Purine metabolism
obo01100  Metabolic pathways
obo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105275628
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105275628
Enzymes [BR:obo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105275628
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258 DUF5368 RINT1_TIP1
Other DBs
NCBI-GeneID: 105275628
NCBI-ProteinID: XP_011330896
LinkDB
Position
8
AA seq 1010 aa
MSQRLQASNEDSYLTWGRPSNLLKTRFSSARLEKLYRASSLQQRRGGLTCFLMSAILYGV
YTLVTPGFELPARGVSGTFLGLSLVLLIWAERGTVARNTLWSLMPCVVWQLWIWHLLAQL
LLRSAPYLKIGANTIKVTPRDSLGWMLLLIYLLFTTLPLRLCRCTFLALVTAIMYVSFVV
FISSPTLQELHMQPFDVLILTVTLFAGAAIFGACSYCLAEFQQRRAFLETRQSLEVQLLI
EEQSAEQERLLLSVLPEHVAVRMRQDFGESFNSQFKKIYMSRHENVSILYADIVGFTAIS
STYSASELVKILNELFARFDQLSERYEQLRIKILGDCYYCISGAPVERPDHAVLCVHMGL
SMVDAIKYVQQTTNSPVDMRVGIHTGAVLAGVLGQRQWQYDVYSKDVELANKMESSGRAG
RVHISNATLSFLNGEFEVEPAHGENREEALQKAGLVTYFIVRALKPFKPAVTKSLASLAD
AENSQRTMESAQGSRNNSREDSEEFQQRLRKKLDSRGGGTDLKVRPSWLTLRFKDPNVET
AFHSVDEAFSPLSLLGGPLVTICAAPVWRLQPWGPFTWGGAGVVALFGVVLAGATCLGSA
VRATWLRRTLALLMIFSLMVFLLLDMSNCAIIDEIEPPANTSLSWSPRCPYPSYYSYVGV
LALVAISMPTYLCYLNKACWMYTLASAQSCINILFLAPSLEREDLSSTPSALFPLKYSLS
GTLFVIATALIIVARHAEKARRMLYLRGREVVAQRERAADMKRRNGALIYNILPPHVAAY
FLSSARHHDDLYSQSYAEVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFDAIL
DQNKFKGIIKIKTIGSTYMAASGITESVKSEDGPRWGHLCTLVEFALELKKALSSINEQS
FNHFVLKMGINHGPVTAGVIGARKPHYDIWGNTVNVASRMESTGKVGCIQVTDETRKILE
PFGFGFEQRGLVFVKGKGQLLTHYLISKDGVSLDLDSDLPVEPTHPIIYQ
NT seq 3033 nt   +upstreamnt  +downstreamnt
atgtcacagcggctgcaggcctcgaacgaggattcttacctgacctggggcaggccgtcg
aatctgctgaagacgagattcagcagcgcccgtctcgagaagctctaccgcgcctcctcg
cttcagcaacgtcgcggtggcctcacgtgcttcctgatgtcggcgatcctctacggcgtc
tacaccctggtgacgccgggcttcgagcttccggcgcgcggtgtcagcgggaccttcctc
gggctgagcctcgtcctgctgatctgggccgagcgcggcaccgtcgcgaggaacaccctc
tggtcgctaatgccgtgcgtggtctggcagctctggatctggcacctgctcgctcagctg
ctcctcagatccgcgccgtacctcaagatcggtgcgaataccatcaaggtcacgccgagg
gacagcctaggctggatgttgctgctgatctatctactgttcaccactttgccgctcagg
ctgtgccgttgcacgtttctcgcgctcgtcactgcgatcatgtacgtctccttcgtggtc
ttcatctccagcccgacgctgcaggaactccatatgcaaccgttcgatgttctgatcctg
acggtgacactctttgccggcgccgctattttcggtgcttgcagctactgcctggcggag
ttccagcagcgcagggcgtttctggagaccaggcagagcctggaggtacagttgctgatc
gaggagcagagcgcggagcaggaacggctgttgctcagcgtcctaccggagcacgtcgcg
gtcaggatgcggcaggacttcggagagtccttcaactcgcaattcaagaagatctacatg
tccaggcacgagaacgtgtcgatactctacgccgacatagtcggcttcaccgcgatctcg
tcgacctacagcgccagcgagcttgtcaagatactcaacgagctcttcgcgcggttcgat
cagctcagcgaacgatacgagcagctgcgcatcaaaattttgggggactgttactactgc
ataagtggtgcacccgtcgaaaggccggaccacgcggtcctctgtgtgcacatggggttg
tcgatggtggacgcgatcaaatacgttcaacagacgacgaacagcccggtcgacatgagg
gtgggcattcacacgggcgcggtacttgccggggtcctcggccagagacaatggcaatac
gacgtttatagcaaggacgtcgagctggcgaataagatggagagcagtggaagggccggg
agggtacacatctcgaacgcgacgctgagtttcctaaacggggaattcgaggtcgagccg
gcgcacggggagaatcgggaagaggcactccaaaaggctggccttgtcacttacttcata
gtgagagccttgaaaccatttaagccggcggtgacgaagagcctcgcgtcgctggcggac
gcggaaaactcgcaaaggacgatggagagtgcgcaaggcagtaggaacaacagcagggag
gattccgaggaatttcagcaacgtctgaggaagaagctcgacagtagaggtggtggtacc
gacctgaaagttcgcccctcctggttgaccctgcggttcaaagatccgaacgtggagacg
gcgttccacagcgtcgatgaggccttctcgcccttgtcgcttctcggcgggcctttggtg
acgatctgcgcggcaccggtctggaggctgcagccctgggggccgttcacgtggggtggc
gccggggtggttgccctcttcggcgtcgtgctggccggagccacctgcctgggcagcgcc
gtcagggcgacgtggctcagaagaaccctcgcgctcctgatgatattctccctcatggtc
ttcctgctgttagacatgagcaactgcgcgatcatcgacgagatcgagccaccggccaac
acgtcgctaagctggtctccgcgatgtccgtatccttcttattactcgtacgtcggcgtt
ctggcgctggtcgctatctcgatgccgacgtacctctgttacctgaacaaggcatgctgg
atgtacaccctcgccagtgcgcagagctgcatcaacatcctcttccttgcaccgagtctc
gaaagagaggatctgtcgtcgaccccgtccgcgctctttccactaaaatactcgctgtca
ggcactctgttcgtcatcgcaaccgcgttaatcatcgtggcgagacacgctgagaaggcg
cgaaggatgctgtacttgcgaggacgagaggtcgtcgcgcagagagaacgagcggcggat
atgaagcgaagaaacggtgcgctgatatacaacatcctgcctccccacgtggccgcgtac
ttcctgtcgagtgcaaggcaccacgacgatctttacagccagagctacgccgaggtgggc
gtgctgttcgccagcatgccgaatttcgcggatttctacagcgaggagagcatcaacaat
caaggcctcgagtgcctcaggtttctgaacgaagtcatctccgacttcgacgccatcctt
gatcagaataaattcaagggcattatcaagataaagacgataggatcgacctacatggcc
gcctcgggaataaccgagtcggtgaagtcggaggacggtcctcggtggggtcatctctgc
accctcgtagaattcgccctggaacttaaaaaagcactgtcgagcatcaatgaacagagt
ttcaatcacttcgttctgaaaatgggcatcaatcatggaccggtgaccgccggtgtcatc
ggggcacgaaaacctcactatgatatttggggcaacaccgttaacgttgcgtcgaggatg
gagagcacaggaaaagtcggctgcattcaggtcaccgacgagacgcggaagatactggag
ccgttcggcttcggcttcgagcagcggggtctcgttttcgtgaagggcaagggacagctc
ctgacgcactatcttatctccaaggatggcgtgtccctagatctcgacagcgatcttccc
gtcgaacctacccatcccataatctaccaataa

DBGET integrated database retrieval system