KEGG   Ooceraea biroi (clonal raider ant): 105277247
Entry
105277247         CDS       T05778                                 

Definition
(RefSeq) fibroblast growth factor 3 isoform X2
  KO
K18496  fibroblast growth factor 1
Organism
obo  Ooceraea biroi (clonal raider ant)
Brite
KEGG Orthology (KO) [BR:obo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:obo04052]
    105277247
   00536 Glycosaminoglycan binding proteins [BR:obo00536]
    105277247
Cytokines and growth factors [BR:obo04052]
 Growth factors
  Growth factors (RTK binding)
   105277247
Glycosaminoglycan binding proteins [BR:obo00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   105277247
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 105277247
NCBI-ProteinID: XP_011333781
LinkDB
Position
3
AA seq 255 aa
MPLTNGRRSKMSLRWIHENLEAPTCDEECSDIDDSCSDDSYDTDLSLQENNDVTENEKGI
VKNEKGIEKKEKGWRKKRETKKPSITTVTFDGKGTVRNIERMSKPRKYSPCVIWDPRQPA
RNPVYNCRTIKLYCRTGYHLAITSSGRVRGLSANNESHALLHVTPVSFGVIRIQNVETRL
YLAFNKKGRLYGEINMTNDNTEWEQWSIGAYDAFRSRKYVHYGWWIGIKKNGRAKPGPKT
SWGQKAIQFSAIQED
NT seq 768 nt   +upstreamnt  +downstreamnt
atgcctcttacgaacgggaggagatcgaaaatgagcttgcggtggattcacgagaatttg
gaagcgcctacgtgcgatgaagaatgcagcgatatcgatgacagctgcagcgacgacagc
tacgatacagatttgtctcttcaggagaacaatgatgtaacggagaacgagaaagggatc
gtgaaaaacgagaaagggatcgagaaaaaagagaaagggtggcggaagaagagggaaacc
aaaaaaccttcgatcaccactgtcaccttcgacgggaaagggacggtacgtaacatcgaa
cgcatgtctaaaccgcgcaagtactcaccctgcgtgatatgggatcctcgacaaccagcg
agaaatccagtctacaattgtcggacaataaagctctactgccgaaccggatatcatctg
gcgattacatcgtcgggacgtgttcgaggattatccgcaaacaatgagtcgcacgctttg
cttcatgtgacgccggtatcttttggcgttatcaggatacaaaatgttgaaacgagactc
tatttggcattcaataaaaaaggacgattatatggagagataaatatgactaacgataat
accgaatgggaacaatggagcatcggtgcctacgacgcgtttcgatcgcggaaatacgtg
cattacggatggtggataggaataaagaagaatgggcgagcgaaaccgggaccgaaaacg
tcttggggacagaaggcgatacaattctcggctatccaagaggattaa

DBGET integrated database retrieval system