KEGG   Ooceraea biroi (clonal raider ant): 105277365Help
Entry
105277365         CDS       T05778                                 

Definition
(RefSeq) glycosyltransferase 25 family member isoform X1
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo00310  Lysine degradation
obo00514  Other types of O-glycan biosynthesis
obo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105277365
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    105277365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:obo01003]
    105277365
Enzymes [BR:obo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     105277365
Glycosyltransferases [BR:obo01003]
 O-Glycan biosynthesis
  O-linked Gal type
   105277365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 105277365
NCBI-ProteinID: XP_011333966
LinkDB All DBs
Position
9
AA seq 583 aa AA seqDB search
MKWYYASPFQTMRITMVLRGYFFIYFFINLTRLVTCDVNTKEPTVLIAILVRNKAHTLPY
FLSLLERQDYPKKRISLWICSDNNVDNSIEILNKWISSESEKYHSLNVYLNASSTGFRDE
RASTDWSPHRFAHVIDLRERALNHARQIWADFIWMLDADVFLINPSTLRKLVHKEHVVAA
PLLKSDGMYSNFWAGMTAEHYYVRTDLYEPILFREKTGCHHVPMVHTAVLVDLRTRESDL
LSYRADKLNAYDGPQDDIITFAVGANKSGVPLFVCNDEVYGFVTVPLENDETIMEDIQRL
TNIKTEILAFSDLPLSDDLKEFVRYPEKDTLGLDHVYMINLLRRPERRKRMWRLFNELGI
QAETIDAIDGRALNETFLKEWGVILMPEYLDPYHNRPMTMGEIGCFLSHYLIWQKVLKHG
YEKVLVLEDDIHFEPFFRQKVNYVLVELSDLKIKWDLVYVGRKKLVKSESRLNGSKFLVR
AGYSYWTLGYMLSASGARKLVGAMPLGKLVPVDEYLPILSDTHPKEQWAAQFPTRDLIAL
STSPLLVYPTHYTGEDGYISDTEDSKLVLDTSESAKSADRDEL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggtattacgcgagcccgtttcagacgatgcgtattacgatggtgcttcgagga
tattttttcatttacttttttatcaatcttacgcggttagttacatgtgacgtaaacaca
aaagaaccgaccgtgttaatcgcgattctggtcagaaacaaggcgcacacattgccgtac
ttcctcagcctactggagcgacaagattatcccaagaaacggatatctctctggatatgc
agtgacaataatgtcgacaattcgatagagatattgaacaaatggatcagttcagaaagc
gaaaagtatcactccctaaatgtttatttgaatgcatcatcgacaggatttagggatgag
agggcgagtactgattggtctcctcacagattcgcgcatgtgatagatctacgcgaacga
gcactcaatcatgcgagacaaatatgggcagattttatctggatgttggatgcagatgtt
tttctgattaatccaagcactttgcgcaaattggtccataaggaacacgtcgttgcggcg
cctttactgaaatcggatggcatgtatagtaatttttgggctggcatgacggcagaacat
tattatgtgcgtacggatctctatgagccgatcttgtttcgcgagaaaacaggatgtcat
cacgtaccaatggttcataccgcagtccttgtagatttaagaacccgcgagtccgatctt
ctatcctacagagccgataaattgaacgcttatgatggaccccaagatgatattataact
ttcgctgtaggagcgaataaatctggtgtaccattgttcgtttgtaacgacgaagtctat
ggtttcgtcacggtgcctttggagaacgacgagactatcatggaagatatacagcgatta
accaacataaagacggaaatactggcgttcagcgacctgcctttgtcggacgatctaaag
gaatttgtgaggtatcctgagaaagacacgctaggtttagatcacgtctatatgataaat
ctattgagacgaccggagaggcgcaaaagaatgtggcgactattcaatgaactcggtatt
caagcggagactatcgacgctatagatggcagggctctgaatgaaacttttctaaaggaa
tggggcgtgatactgatgccggaatatttggatccttatcacaacaggccgatgacgatg
ggcgagatcggctgcttcctcagccactacctcatatggcaaaaggtgctgaaacacggc
tacgaaaaagttttggtgctggaggatgacatccacttcgaaccgttttttcgacagaaa
gtcaattacgttttggtagagttgtccgacctcaagatcaagtgggacttagtatatgtg
gggaggaagaaattggtgaaatcggagagtcgactgaatggctccaagtttttggtgcgg
gctggatatagttattggacactgggctacatgttgtcggcgagcggagcgaggaaattg
gtgggcgccatgcctctcgggaaattagttcccgtcgacgagtatcttcccatactttcg
gatacgcatcctaaggagcagtgggccgcgcagtttcccacgcgggacttgattgcatta
tcgacaagtccgcttcttgtttatcccacgcattataccggcgaggatggatacatcagc
gacacggaggactcaaaactcgtgctggacacttccgagtccgcgaagtcggcagaccgt
gatgaactgtga

DBGET integrated database retrieval system