KEGG   Ooceraea biroi (clonal raider ant): 105278548Help
Entry
105278548         CDS       T05778                                 

Definition
(RefSeq) trypsin-1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:obo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105278548
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:obo01002]
    105278548
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:obo04147]
    105278548
Enzymes [BR:obo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     105278548
Peptidases [BR:obo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   105278548
Exosome [BR:obo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105278548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 105278548
NCBI-ProteinID: XP_011336015
LinkDB All DBs
Position
1
AA seq 247 aa AA seqDB search
MLIILCLSLIVSASCLRPRIIGGEPTTIDKHPHQVSIHYNGKLMCGGSIISKQWILTAAH
CVYGGRLQLFKVRIASSYHDEGGVLIESIDSIIPHEWYDDDTYDYDVALIKLTKPLSLDR
NTKIITLATPSTSVKPGSTTVVTGWGKTSVNGASSKVLRVLMVPIIDQEVCRKIYARHRI
VTANMLCAGYITGAKDTCQGDSGGPLVYNGVQIGIVSWGAQCASVGYPGVYTRVSAIRSW
ITKRANV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgctaattatactctgcctgtcgctgatagtttccgcctcgtgtttacggccgagaata
atcggaggcgagcccacgaccatcgataagcatccgcatcaggtctccattcattacaat
ggcaagctcatgtgcggaggatcgataatcagcaagcaatggatcttaacggcagcgcat
tgtgtctacggcgggagactgcagctcttcaaggtccggatcgccagcagttatcacgat
gagggaggcgtcctgatcgaaagtatcgactcgatcatcccccacgagtggtacgacgat
gatacctacgattacgacgtagctctgatcaagctaactaaacctctatcgctggatcga
aacacaaaaatcatcactttggcgacaccatcgacatccgttaagcccggcagcacgacg
gtcgtcacaggctggggcaagacgtcggtgaacggcgcgagctcgaaagtgctgcgggtt
ctgatggtgccgatcattgatcaggaggtctgccggaagatctacgcgcgtcatcgtata
gtgacggccaacatgctgtgcgccggctacatcactggtgcgaaagacacctgtcaggga
gactccggcggcccgctcgtgtacaacggcgtccaaattgggatcgtgtcctggggcgca
cagtgcgcaagtgttggatatcctggggtgtacacgcgagtatccgccatacgtagctgg
ataaccaagcgggcgaacgtgtag

DBGET integrated database retrieval system