KEGG   Ooceraea biroi (clonal raider ant): 105279722Help
Entry
105279722         CDS       T05778                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo04146  Peroxisome
obo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:obo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105279722
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105279722
Enzymes [BR:obo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105279722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 105279722
NCBI-ProteinID: XP_011337976
LinkDB All DBs
Position
7
AA seq 152 aa AA seqDB search
MVKAVCVLQGEPIKGTVFFEQAEGSSSVKVTGEVSGLQKGLHGFHVHEFGDNTNGCTSAG
AHFNPLGKDHGGPSHSVRHIGDLGNVEAGADGVAKVNITDSMIQLSGSHNIIGRTLVVHA
DPDDLGQGGHELSKTTGNAGARLACGVIGITK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggcggtctgtgtccttcaaggcgagcccattaaggggaccgtgtttttcgaa
caagcggaaggttccagttcggtcaaggtgaccggagaagtttctggcttgcagaaaggt
ctgcatggtttccacgttcatgaatttggcgacaataccaatggttgcacaagcgcaggc
gcccatttcaacccattgggaaaagatcatggtggtccaagccattctgtacgtcacatc
ggagacttgggaaacgtagaagctggtgctgacggtgtcgcgaaggtcaacatcactgat
tccatgattcagctcagtggatcacacaacatcattggacgaactctcgtggtccatgct
gaccctgacgacttgggccaaggtggtcacgagctctccaagacaaccggtaacgctggc
gctcgtcttgcctgcggcgtcattggtatcacgaagtaa

DBGET integrated database retrieval system