KEGG   Ooceraea biroi (clonal raider ant): 105280041Help
Entry
105280041         CDS       T05778                                 

Definition
(RefSeq) peroxisomal multifunctional enzyme type 2
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo01040  Biosynthesis of unsaturated fatty acids
obo01100  Metabolic pathways
obo01212  Fatty acid metabolism
obo04146  Peroxisome
Module
obo_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    105280041
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105280041
Enzymes [BR:obo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     105280041
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     105280041
    4.2.1.119  enoyl-CoA hydratase 2
     105280041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short MaoC_dehydratas adh_short_C2 SCP2 KR Alkyl_sulf_C MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 105280041
NCBI-ProteinID: XP_011338514
LinkDB All DBs
Position
13
AA seq 728 aa AA seqDB search
MSELRFDNRVVVVTGAGAGLGRAYALLFASRGASVVVNDLGGSRHGDGSSTKSADAVVAE
IRRNGGKAVADYNSVLQGDKIVQTAIDAYGRVDVVINNAGILRDTSFAKMTMEQWDAIYD
VHLKGAMITTKAAWPYFYKQNYGRIIFTSSNSGLYGNFGQTNYSTAKLGLVGLANTLALE
GKKRNIYTNVIVPTAASRLTEDVLPPDFFEHMKPELIAPVVFWLCHENCTENGSIIESAL
GWAGKCHLVRSTGCILRQDLSADVTPEAVKENWSQIINMKKAKRCNTIHDATQELMYVFD
SLSTPDSLSSTVVSSSSEEENIMISRYNNRDVILYALGVGATVAEADDLRYLYENHDNFA
ILPTFFTTYGPMGCIETSVLQTALPNIEFSLAQILHGEQYLEVLKPLPVEATLETRFKVQ
DVMDKGKGVVVLVQHDTYNGATEEKLSTGQISVFITGVGGYGGKRSSDHIIPTVQPPARK
PDVVYEQKTSVDQAALYRLSGDYNPLHIDPNFSAIAGHRIPILHGLCSLGFSTRHVIKTF
AGGDPHLFKCLKVRFVKPVIPGDTLRTEMWRNGKRIHFRTSTDSTKDVIAGAYIDLLEVV
EPMLKANRCSASVDLQSDAVFVAIGEHVKTNPEKVKKVNGIFLYNITVDGKVASEWTLDL
KNAEVHKGKPKSGKADTTLTIDDKDMVEIALGKLNPQTAFMRGKLKITGNIMLTQKLKGL
MEMNNAKL
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaactgcgtttcgacaaccgtgtcgtcgtggtaacgggagctggagcaggatta
ggtcgagcgtatgcgctactatttgcgtccagaggtgccagtgtggtcgtaaatgatttg
ggaggcagcagacacggggatggaagtagcaccaaaagtgcggatgccgttgttgcagaa
attagacgaaatggaggaaaggctgtggcagattacaactctgtactccagggtgacaaa
atcgttcagacagcgatcgatgcgtacggccgtgtggatgtagttattaataatgccggc
attttgcgagatacatctttcgcgaagatgacaatggagcaatgggatgcgatatacgat
gtccaccttaagggagcaatgataacaacgaaagcagcgtggccatatttttataagcag
aactacggccgcataatttttacttcaagcaatagcggtttatatggcaactttggacaa
accaattacagtacggcaaagctgggtctcgtaggactagctaatacactggccctcgaa
ggaaaaaagagaaatatttacaccaacgtaatagtgcctacagctgcttcgcgcttgacg
gaagatgtccttccaccggactttttcgagcacatgaagcctgaactgatagcacccgtc
gttttctggctgtgtcatgaaaattgtacagaaaatggttcgataatcgagtcagcatta
ggctgggctggcaaatgtcacttggtccgctctacgggttgcattttgcggcaagatctg
tcagccgacgtcacgccggaggctgtgaaggagaattggtcgcagataatcaacatgaaa
aaagcgaaacggtgcaatacgattcatgacgcaacacaggaattaatgtacgttttcgac
agcttgtctactcctgattctctttcctctactgttgtctcttcttcttctgaggaagaa
aatatcatgataagcagatacaataatcgtgacgttatactgtatgcgcttggagttgga
gctaccgttgccgaggcagatgatctacgttatttatatgaaaatcacgacaactttgcc
attttgcctactttcttcaccacgtacggacctatgggatgcattgaaacttctgttctg
cagactgctttaccaaacatagaatttagcctagcgcagatcctccatggagaacaatat
ctggaggttttgaaacctctgcctgtcgaagccacattagaaacgcgcttcaaagtgcaa
gatgttatggacaagggaaagggcgtcgttgttttagttcaacatgatacatataacggg
gcgactgaagaaaaattgtcgactgggcagatatctgtatttatcactggtgtaggtggt
tacggtggaaaacgcagctctgaccatattattccaaccgttcagcctcctgctagaaag
ccggatgttgtatatgaacaaaaaactagtgttgatcaggctgctctttatagattgagt
ggagactacaatcctttgcacattgatcctaatttttccgcaattgctggacatagaata
ccaatattacatggactgtgttcgctgggattctccactcgtcatgttattaaaacgttt
gctggtggcgatccacacttgttcaaatgcctcaaggtaagatttgtaaaaccagttatc
ccaggcgacacattgcgcactgaaatgtggcgtaacggtaagagaatacatttccggacg
agcacagactctactaaggatgttatagcaggtgcatatatcgatctactcgaagttgtt
gaaccaatgctgaaggcaaaccgatgctcggccagcgtagatttgcagagcgatgctgta
ttcgtggcgatcggtgaacatgtgaaaacaaatccggaaaaggtcaagaaagttaatggg
attttcttatacaatattaccgttgatgggaaggtggcatctgaatggactcttgacttg
aagaatgctgaagtgcacaaaggaaagcctaaatctgggaaggcagataccacgctcacc
attgacgataaagatatggttgaaattgcactgggaaaattgaatccgcagacggcattt
atgcgtggcaaactgaaaataactggaaacatcatgctcacgcagaaattgaaaggtctc
atggaaatgaacaacgcgaagttgtaa

DBGET integrated database retrieval system