KEGG   Ooceraea biroi (clonal raider ant): 105280257Help
Entry
105280257         CDS       T05778                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo03030  DNA replication
obo03410  Base excision repair
obo03420  Nucleotide excision repair
obo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:obo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105280257
   03410 Base excision repair
    105280257
   03420 Nucleotide excision repair
    105280257
   03430 Mismatch repair
    105280257
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:obo03032]
    105280257
   03400 DNA repair and recombination proteins [BR:obo03400]
    105280257
Enzymes [BR:obo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105280257
    6.5.1.6  DNA ligase (ATP or NAD+)
     105280257
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105280257
DNA replication proteins [BR:obo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105280257
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105280257
DNA repair and recombination proteins [BR:obo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105280257
   NER (nucleotide excision repair)
    Other NER factors
     105280257
   MMR (mismatch excision repair)
    Other MMR factors
     105280257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 105280257
NCBI-ProteinID: XP_011338912
LinkDB All DBs
Position
1
AA seq 974 aa AA seqDB search
MYIVLNDVADVLCLCSSFFTKLPSKKENSTESKSESSLALPARRLEYAAVTRSRFLVIFN
GIHTTNSNNSSNKQEAHHDAQGNGKRKRDSSSELASSPLSKKLDTKSTKAKRISKTPSPA
AKPRVKLGATPKSKSNKLSPGASKKTEKKKEKTSVTVNKKREEKKEKDEANEAKSVKDNE
KEEKNSTDSKVNLERKSVSKTVKKKRARIIEPVESSDDEDHLPLPESPERKNSPKKPEPN
GKEIKIVEESSKVDKNTLDNEANKSASDNEEKSKSPKKESMPEKKPPKKVHSFLLSKQKS
DTKDDKRNGGKTRKSADQSYNPSASGYHPINDACWKRGDKTPYSAFTRTLELIEETSARL
KIIEILSNYFRSVIVLSPADLLPSVYLCLNQLAPAYEGIELGVADTNLMKAIAQCTGRTL
AQIKADVQEVGDLGIVAEGSRSNQRTMFQPAPLTVPNVYTKLKEIAQMTGHASLAKKLDK
IQTLFVACRNTEARYLIRSLAGKLRIGLAEQSVLQALALACAMTPPEQEYPSEILNASKT
MSSDRFKEKYDQIAITLKTTYCECPNYNLIIPVLLEAGINALPTKCKLTPGIPLKPMLAH
PTKGVQEVLTRFDGLKFTCEWKYDGERAQIHVADNGQVSIYSRNQENNTSKYPDIIKRFK
NTCGDLVKNCVLDCEAVAWDNGKKQILPFQILSTRKRKDANEEDIKVQVCVFMFDLLYLN
GESLVKQPFAKRRELLREHFKEVEGEWKLANSMDTTTMEEVQIFLDESVKGNCEGLMVKT
LEEEATYEIAKRSRNWLKLKKDYLDGVGDTLDVVVIGGYIGKGKRTGTYGGFLLACYDQE
NEEYQSICKIGTGFKEEDLENHTKFFKDHVISQAKSYYRFDSSHEPDHWFESIQVWEIKC
ADLSLSPVHRAAIGVVDPEKGISLRFPRFIRIREDKNCEEATSAQQVADMYNNQEQIKNQ
KNQSASKTAEEDFY
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcgttttgaatgacgtcgccgatgtactttgtctttgcagctcctttttcacc
aagttaccgtccaagaaggaaaattcgaccgaaagtaaatcggagagttcactggctcta
ccggcccgacgtctggagtacgcggctgtgactcgtagtcgatttcttgtcatttttaat
gggatacatacaaccaacagcaacaactcatccaacaaacaggaggcccaccatgatgct
cagggaaacggcaaacgaaagagagacagcagcagtgagctcgctagttctcctctctcg
aaaaagctagatactaagtctacaaaggccaagagaatttccaaaactccttctccagct
gcaaagcctcgtgtaaagttaggagctacgccaaaaagtaagtcaaataaactttcacct
ggagcatcgaaaaagacagagaagaagaaagagaaaactagtgtaactgtaaacaaaaaa
agagaagagaaaaaagaaaaagatgaagcaaatgaagctaagtctgtaaaagataacgaa
aaggaagagaaaaattcgactgattcaaaagtcaatttggaaagaaaatctgtaagtaaa
actgtaaagaagaaacgagccagaataattgagccagtagagtcgagcgacgatgaggat
cacttacctttgcctgaaagtcctgaaagaaaaaatagtccaaaaaagccagagcctaat
ggcaaagaaataaaaatcgtagaagagtctagcaaagtcgacaagaacactttggataat
gaagcaaacaaaagtgcttcggataatgaggaaaaaagcaaaagtccaaagaaggaatct
atgcctgaaaagaagccgcccaagaaagtgcatagctttttactatcgaagcaaaagagc
gatacaaaggatgacaaaaggaacggcggaaaaactagaaaaagtgctgaccaatcttac
aatcccagtgcatctggttatcatccaataaacgacgcgtgttggaaacgaggagataaa
actccatatagcgcattcacgcgtactttggagctcattgaggaaactagtgcgagactg
aagataatagagatactgtcgaattacttccgatctgtcatagttctgagcccagcggat
ctgttgccgagcgtgtatttgtgccttaatcaactagctccagcgtatgaaggaattgag
ctcggtgtggccgacacaaatttgatgaaggcgatagcacaatgtaccggcagaacgttg
gcacaaatcaaagctgacgtccaggaggtcggtgatttgggaatcgtggcagaaggtagc
agatccaatcagagaaccatgttccaaccagcaccactgaccgttcctaatgtgtacaca
aaattgaaggagatcgcacaaatgacggggcatgcgtctctcgcgaagaagttggataaa
attcagacgctgtttgtagcgtgtcgtaatactgaagcgaggtatctcatcagatcgttg
gccggaaaacttcgcatcggattggcagagcaatccgtcttgcaagcactggctctagct
tgtgcgatgacgccaccggaacaagaatatccatcagaaattctaaatgcaagcaaaacg
atgtcaagtgatcgtttcaaagaaaaatacgatcagatagctattacattaaagacaacg
tattgcgagtgtccgaattacaaccttataattcccgtcttactagaggctggcattaat
gccttgccgaccaaatgcaaacttactcctggaatacctttgaaacccatgttggcgcat
cctactaagggtgttcaagaagtcctcacacggttcgatggcttgaagttcacgtgtgag
tggaaatacgacggggaaagagcacagatacacgttgcggacaatggtcaagtcagcatc
tacagtagaaatcaagagaacaataccagcaagtatccggatattattaaacgattcaag
aatacttgtggtgacttggtgaaaaactgtgtactcgattgcgaggcggtcgcctgggac
aacggaaagaagcaaattctaccgttccaaattctcagtacgagaaagcgaaaggatgcc
aacgaagaggacatcaaagtgcaagtgtgcgtgttcatgttcgatctgttgtatctgaac
ggcgagtcgttggtgaagcagccgttcgcaaaacgccgcgagttattgcgagagcatttc
aaggaggtagaaggcgaatggaaattggctaatagcatggacactacaacaatggaggag
gtgcaaatattcttggacgagtccgtgaagggaaattgcgagggtttgatggtgaagaca
ttggaggaagaagcaacttacgagatcgcgaagcgatcgcgcaattggctgaagctaaag
aaggattacttggacggtgtcggcgatacgctcgatgtcgttgtaattggtggttatatc
ggcaagggaaagagaactggcacctacggtggcttcctcttggcgtgttacgatcaggag
aacgaggagtatcaaagtatttgtaagatcggtacgggtttcaaagaggaagacctcgaa
aatcacacaaagttcttcaaagatcacgtgatatcccaagcaaaatcatactatcgcttc
gacagtagccatgagccagatcattggttcgagtcgattcaagtctgggagatcaagtgc
gccgatctctccctctcgcctgttcatagggcggctattggagtagtcgatccggaaaag
ggaatatctttgagatttccacgatttattagaatccgcgaggacaagaattgcgaggag
gcaacgtccgctcaacaagtcgcggacatgtataataatcaagaacagataaaaaatcag
aaaaatcagtcagcatcgaagaccgcggaggaagatttctattaa

DBGET integrated database retrieval system