KEGG   Ooceraea biroi (clonal raider ant): 105282895Help
Entry
105282895         CDS       T05778                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 13B
  KO
K19526  vacuolar protein sorting-associated protein 13B
Organism
obo  Ooceraea biroi (clonal raider ant)
Brite
KEGG Orthology (KO) [BR:obo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    105282895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VPS13_C Chorein_N SHR-BD VPS13 ATG_C
Motif
Other DBs
NCBI-GeneID: 105282895
NCBI-ProteinID: XP_011343506
LinkDB All DBs
Position
2
AA seq 3763 aa AA seqDB search
MFKLESYITPVILSYVEKYVKNFKPEQSQVSLWGGDASFQNLDLRLEVLEEQLNLPFVFV
SGHIHELLIHVPWVKITSEPIVVTINTIECILKLKDENNAETNTAILQKTKEIVQEEAPP
GYIKSIVTKVINNITINCNNLILKYVEEDIVLSVNVRFLSMHTVDNKWEPAFAEVNTQEV
MLRKVITIQDLTLCLDKMDASGKIEIYQDPVLYRCSMTIRMIINYHSNTSKRASITRLDL
HCEKMEFSMTEQQVPMLLRLATLVMALQTKQFPPSREKSSITMDEKEDVIQDDTNQVAGT
SADAVGWGGWAWDMVSSFLPVDHDWSAEQQLAYSGHIVHLGVYIDDATLTFKIVESVKEQ
LFYKSRKLRYKSFLSLQLNGVVIDTLIQGIAMTTFQVGVTCIQLYPRGTCSCGHLEVVDG
VQPPLYVTAGSLNIDYLKDSLFDDEAIENKGKKREYKQGVDNHLTTVSVEKLLERCPAAV
MDYTYFVELPDDITPEKLLELGPSFEYSNFQERRVIRYLAGDLTIRLCSGIFHRVDTIKQ
AAAKYDYDPYLVIKPDPLIDELPPVTLEEYEALRENVSMTETRLILKRASLQLQLADHYV
TGMPRQRKIVEARTTPLSPALTDDPFVSIECDEAVATIIQPMYPFRLVACASKLTELPPE
MFPQCHVITDIQVIGAKSQLHLTKTCDTSIVMPYSVDATSKTLLYPQYWRDVDMIQKSYS
FQSDSITITGTKAKLLAATSIVTSVFNPEDTTNPLVSSTLFNDACQEKSPVYLELYIENI
NCKNVSSSVIVSSKMNVGSVKIFALNDSQQAFILSGPENRDGSDAVNVPLLSAVIQFPKK
LELQTYPPLVSFKVAEIRASMDPLFLEWLEYRAAHHKLGSVHVLRSDSQQLITEGTSSDT
ATRKKTFPSLHESVHSSSDKEKRRAVTEKSKTLRNDEAQRKDECKTEGDQQKSGLLIRLA
ESYSWWCSLVLSGYIGHIIIYIPSDTMSGIGADGIEQAKDRAIVEDHALQIMIIKLPSLL
IHSSNLNADLLSPHLQNLPVRLPEPIWTYRIQSFPWTLSLIDFHCYTLQQQVQKNFIKKV
TLNATVALTTKTAATQSNVLTALSVCVHIDNSPIIISLSEEQVIFMSNIALNIIKVLRTL
CDSQEDNAIIPQMNNEAPILPVIPQTPSTPTQIMYQEDTTTNSTMSTSKDDQGCEKDGLI
VTAWIQWTITKIAVKLYIMGQADTSSLKLILELEDIITSLDLQSIYMQLKSKITTATVFH
YIRAPHALNWDIGEYAGLVLCGREDNIEKGDDSGFLSFTLTRAKSGNVYTRWGTHKRYKP
QKKELLIDSALSTSNYISEILIKMQMVDVILPLSVISRYTQLIKPFACLGSSIEKSTDVA
RGKSTATPLDGITNLNNESLPLIHLEFKGFRLMMPALTDTNKLQHDLLMVQLDGIRITPD
AENPICRTPLRTDIYQLAAQANILNVPGSAVEDRQYQISVKGVCAYTTTWKNYQLSINKR
MSQSYLYTMNENPALEWNKLGNGSSLDPYFSTSPVLTKFDLCLIIAPAITFKADTIVCGS
AVEVNCITDIELTINLDQIKLISALNDEFVTLLSESFEKAEDINDSTNTIQRFTSGSQSI
KPISWLKQTSNDSDLDLTKDSGVDFEMSSMHSTVIGRATVAESMILSPFEFLVNCGKITF
ILYEVQSTCLDLQDDIDTDRTDSEDDNDNVKQPLLYLMINQPNIYFSQQHLSKKIQISCF
DITIALGDVQNLSAIPTEKDFKVYMIETKHGDPHPDTGIPPSFATIKSETILGKNRQFFI
EMGRPTKIYFSLSRFHQLSNIRNKVLSCFIDGGITQVPVEEADAANMDSQNSAVPKSKKI
SVPDLNLSTKQIVLSLKTDSGAEIISSLASLSGNLSTLLRPDRIYSNLSIDSFIVSAILN
GNIKVLLNPWCCNVTTCLLWESSYSSEIIPQIQIQADSESLYLDFGPDQIKIMKMVIQDC
QLLLRELASFSASENKDEKQLVLSTEQHYKDDLKAGAFQFVDGTADELPFPYQVVFFAYP
QQAMAWRYPQPRTLTRIHISPVPFEAADVDNSYIGKIPCVLEYWSDSHMSYQRYAEFYLS
ETNSYRLDLPEKAPARAVACVWRVIILSNSKRPLSKSIVSARALAACLRIDSYFNSLIIP
NVQIALNVGVLHVSLYNHIDTTVYNSLPPPLDRYTLNGRIPEIQCFMSLEQKGAVLVFNK
WKDNSMLLDINGTLSMHVLDYSHLTMQEVLDALEGRFQLSLSDKVDASLTCNPFTLKLGP
AITHTLAVSAHLWLASFDEEEKNVIVLTRYVIANDSNISIRFGQSGTGDNILLESRQCNF
YSWRQIGNQMIRISIEENAWVWSRPFPVNKDGIQVVEFNNPTANTIIFVNVTSFSATQKL
VTFSGQLVIANQLIDNFEMRLVKYEAEVGSQVTVSKEVYPIPSKSFPSSIVLENNRKMAM
RLRFTNLTHLSWTGDIPLQPNVKWGQPWLVKVPLQERGQFLSIWVRIVTQVIQDKVKILA
VLSPLYMIRSHLPVPARVQMETPSLKTSSSTTVNGRGERQQLYCPGTFEHFHQLTFQLES
GVSASNPYVPLSYSSVDQRKFFRRPEVEDIDKILQDLRDRKDEMKWPFQGDDTEEWISAE
QPQTHVQVKYQDAGLVSSTLLLELQPWCFVMNSLGCHISLVSEDTELCQIPHYGIVTPPK
LEGTFHVGVGIGDTYYTSQTLQLARLDWSQSFYMPRICGLIPLEGNIKTFVDCGTSVSIL
SINSSMYEDMRLVRITSSHVIANLTSQELCVATLAVHEQASDLQLPHDLTPCSLNILPSE
DQKQGTPIVQWYTLYTDSNVEPLMLYISLSLGHRWSCPIRVDQPMSRKSVAIPNGSSSMP
VIVTTQEDKGITFIVIHSDDHPQLLIENACGFKILLGQADESGNEILSDSAHFTWICEVD
SGGTFHYSLPCVSNRLPDTAIPSASNVLLFSTVQNDQVVGKGNLKWSRGVNLSALSSTPM
DQYLRLPSYGDVKLIMQSLCYTTLISIVPISQIEISAQDIRSRLQRKKNLAKDYDATYTT
YPSSSRRPEEEKLSLHVQSSNSATSLTSFFSAQEDMLSTEGIVSASSSKQLIPNITNTKT
YTDENRLRPTSDVNSNPKEGSVTVYLRTCTIIILHDINENAQRIEVASLSMTDLVVTINS
RARFINMCCYIGDLQLDNQLFDQGGFDFPVVLISQNPLPNREVVFHSSNCLMSNMEKIKQ
DSLITIEYIWEVNGNIIASKEYRMKIAPISAYIEDTYITQLLDYATSMIPPRLVLGDSPK
KIQTIAVSNAVHIPDYIMIDSKILSKPLRLQNFVIEPLSILLSVHTSVRLYVALDHSPLY
FGTFERKNLLTTPYRLGNALIMHYLSGAIFGAGWVVGSLEILGSPGGLAQALGSGLRDFV
SLPFQGLLQGPWGFIVGITHGSASLMKHVTAGTVNSVTKLASSVARNLDRLTLDEEHLQR
QEESRRMRPQGMAQGLYQGLTGFGMSLLAAVAGLAHHPLQQAWSGEATTKSLVTGVGLGL
VGVVTKPLSGAAELVALTGQGLLQGAGWNPLPMPRQRPIVQYTTGNNSTSVRYTWRLSPL
LDHSHDSILHVTSADYVIHQGSNRAVTLVLTRQALLLVNMAEDSVERIFSLKELTSVDHI
TESTMLCLYCPPAATQSSRPLSPAEHEMNQEMRARVEEYVRTSSTGLASVSTNSDRQSDT
FERTSPHPEHTLTFYVCPDTRNYLLSLFNIAKRQNQGSGFAVL
NT seq 11292 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattggaatcctatataacaccagtgatcctcagttacgtagaaaaatatgta
aaaaattttaagccagaacaatcacaggtatccctgtggggtggagatgcatcgtttcaa
aatttagatttacggctagaagttttggaggagcaacttaatcttccatttgtctttgtc
agtggccacatacacgaactgctgatacatgttccttgggtgaaaattacatctgagcca
atagttgttaccattaatactatagagtgtattttgaaattgaaagatgaaaataacgca
gaaactaatacggcgatactacagaagacaaaggagattgtgcaagaggaagcgccacct
ggatacataaaaagcatagttacaaaagtcattaataatattaccatcaactgcaataat
ctcatcttgaaatatgtggaggaagatattgtacttagcgtaaatgtcagatttttaagc
atgcatactgttgataataaatgggagccagcgtttgctgaagtaaacactcaagaggta
atgcttaggaaagtcattactattcaagatttgacgttgtgcttggataagatggatgcg
tcgggaaagatagaaatatatcaggatcccgtcctatatcgctgctcgatgacaatccgt
atgattataaactatcacagcaatacctcgaagagggcgtccatcacgagactcgatctt
cattgcgaaaagatggaattcagcatgaccgagcagcaagtaccgatgctgctgagactg
gcgactttagtgatggcattacaaacgaaacaattcccaccgagcagagagaaatcttcc
atcactatggatgagaaggaagacgttatacaagacgacacgaatcaggtagcaggcact
tccgcagatgcagtcgggtggggcgggtgggcttgggacatggtatcgtcctttctgccg
gttgatcacgactggtccgctgagcaacaactggcatattctggtcacattgtacactta
ggcgtttatatagacgatgctactttaacatttaagattgttgaaagtgtgaaagagcag
ttattttataaatctcggaaacttaggtacaaatcgtttttatcgcttcagttgaacgga
gtcgtgatagatactttaattcaaggaatcgcgatgactaccttccaagtcggagtgaca
tgcatacagctctatccgcgggggacgtgcagttgtgggcatttagaagttgttgatggt
gtacagccgcctctttacgtaacagctgggagcttgaatattgactacttgaaagattca
ttgttcgatgatgaagcgattgagaacaaagggaagaagagagagtacaagcaaggagta
gataaccatttgacgacggtctcagttgaaaaattgttggaaagatgtccagcagcagtg
atggattacacttattttgtcgaactgcccgacgatataacgccggaaaaattgcttgag
cttggaccaagctttgaatacagcaattttcaagaacgcagggtaattaggtatctagca
ggagacttgacaatcagattatgctccggtatttttcatcgtgttgacaccatcaagcaa
gctgcagcaaaatacgattatgatccctacctcgtaataaaaccagatcctcttatcgat
gagctgcctccggttacattggaagagtacgaagcgcttagggagaacgtatcgatgaca
gaaacaaggttgattttgaaaagggcgtcgctgcaactgcagctagcagatcattacgtt
acaggaatgccgcgacaacgcaaaattgtcgaagcgcggactactccgctgtcgccggct
cttacagatgatcctttcgtgagcatcgaatgcgatgaagcggtcgctacaataattcag
cctatgtatccgttcagacttgtagcttgcgcatcaaaattgacagaactaccaccagaa
atgtttcctcagtgccatgtgatcactgacatacaagtgattggagcaaaaagtcaactt
cacttgacaaagacctgtgatacttcaatagtaatgccttattcggtagacgctacttcc
aagacattgttgtatcctcaatactggcgggacgtggacatgattcagaaatcgtactct
ttccaatcagacagtattaccatcacgggaactaaggcaaaattgttggccgctacgtct
atagtaacttctgtttttaatcctgaagatacaacgaatccactcgtgtcttctactctt
ttcaacgatgcctgccaggaaaaaagtccagtgtatctagaattatacatagaaaatatc
aattgcaagaacgtctcatcttcagtcatagtatcaagcaagatgaatgtaggatctgtt
aaaatatttgctctaaacgattcccaacaagcctttatcctttcgggtccagagaatcgt
gacggcagtgatgcagtgaatgtaccgcttctgtctgctgtgatacagtttcctaagaaa
ctcgagctacagacgtacccgccgcttgtttcgtttaaagtagccgagatcagagcttca
atggatccactcttcctcgagtggctggagtatcgtgctgctcatcacaaattgggaagc
gtacatgttctacgttcagacagccaacagttgatcaccgaagggacatcgtccgacaca
gctacgcggaagaagacattcccgagtttgcacgagagcgtgcacagttcatcggacaaa
gagaagaggagagctgtgacggaaaagtcaaagacgttacgaaatgatgaggcgcagagg
aaagatgaatgtaaaacggaaggcgaccaacagaaatctggattattgatcagattagca
gagtcgtattcgtggtggtgcagtcttgtactaagtggttacataggacacattatcatt
tacataccatctgacacgatgagtggcattggagctgatggcatagaacaagctaaagac
agagccatcgtagaagatcacgctctacaaataatgataatcaagttgccaagtcttctt
atacattcgtccaatctgaatgctgatttgcttagcccacatctgcagaatcttcctgtt
agattgccagagcccatatggacctatcgaatacaaagttttccatggacattaagtctt
atcgactttcactgttacacattgcaacaacaggtacagaagaatttcataaaaaaagtc
acgttaaatgctacggtggctcttactaccaagacagctgcaactcagtcaaacgtgctt
actgccctaagtgtctgtgtacatattgataattctcctattattatttcactctcggaa
gaacaggtcatttttatgagcaatatagcattaaatatcataaaggtattacgtactctg
tgtgactctcaggaggacaacgcaattataccacagatgaacaacgaagcgccaattctc
cctgtcatacctcaaactccgtccactccaactcaaataatgtatcaggaagacacgacc
accaattcaactatgtctacttcgaaggatgatcaaggatgtgaaaaagatggtttaatc
gtgacagcgtggattcagtggaccataacaaaaatagcagttaaattgtatattatggga
caggcagacacatcttcattaaaattgatactagaactggaagatatcataacatcttta
gacctgcaatcgatttatatgcaactgaaaagtaaaataacaacagctacggtattccat
tatattagggctccacatgcactaaattgggatatcggcgaatatgctggcctggtactc
tgcggaagagaggacaacatagaaaaaggtgatgattccggtttcttgagtttcacactt
accagggcgaaatcggggaacgtgtacacacgttggggtactcataaacgttacaaacct
caaaagaaagaactgctgatcgattctgcattgtccacgagcaactacatttcggaaata
ctgatcaaaatgcaaatggtcgatgtgatcttaccactcagcgtaatcagcaggtatacc
caattaataaagccttttgcatgcctcggttcatcaattgagaaaagcacggacgtcgct
cgtggtaaaagcacagcaacaccattagatggtataacgaatctgaataatgaatcttta
ccattgatacatttggagttcaaaggttttcgactcatgatgccagccttgactgacacg
aataaattacagcacgatctactgatggttcagttggatgggattcgtatcacaccggat
gcggagaatccaatttgcagaacccccttacgcactgatatatatcagctagctgcacaa
gcaaatatattaaacgtaccaggttcggctgtggaggatcgtcagtatcaaattagcgtc
aaaggagtgtgtgcatacaccaccacatggaaaaattatcaattaagcatcaacaagaga
atgtctcaatcatatctgtatacgatgaacgagaatcccgcattggagtggaataaactc
ggcaatgggagcagcctggatccatatttttctacgtcacccgtattaacaaagttcgat
ctttgcttgattatcgcaccagctattacgttcaaagcggacacaatagtctgcggaagt
gctgtagaggtgaactgcatcacggacatagaactaacaataaatttagatcaaattaaa
ttaatatcagctctcaatgatgagtttgtaacgttgctgtcggaaagtttcgagaaggca
gaagatataaacgattctactaatacaattcaaagattcacttcaggatcccaaagcatt
aaacctattagctggttgaaacagacgtcaaatgattcagatctagatttgactaaagat
agtggggtcgattttgaaatgtccagcatgcattcaacagtaattggaagggccacagtt
gctgaatccatgatactttcaccttttgaatttctagtgaattgtggaaaaataacattc
attttgtatgaagttcaaagcacgtgtcttgatttacaagatgacatagatacggatagg
actgatagcgaagatgataacgataatgtgaaacaaccattgctttacctaatgattaat
cagccgaatatatatttctcgcaacaacatttatcgaaaaagatacaaatatcgtgtttc
gatataacgattgcacttggtgatgtgcaaaatctaagtgcgattccgactgagaaggac
ttcaaagtttacatgatagaaacaaagcacggtgatccacatccggacacgggtatcccg
ccttcttttgcgacaataaaatctgaaacgattctcggcaaaaatcgtcaatttttcatt
gaaatgggacgaccaacgaaaatatatttttccttgtcacggtttcaccaactttctaac
ataagaaataaggtgctgtcgtgttttattgatggtggaattacgcaagtgcctgtagaa
gaagcagatgctgcgaatatggattcgcaaaattcagcagtaccgaaatcgaagaaaatc
agtgtacctgatttaaatctaagtacaaaacaaatcgtgctatccttaaagactgattcc
ggggcagaaattattagcagtttggcatcgttaagcggaaatctgtcaacacttctgaga
ccagacagaatatattcaaacctatctatagattccttcattgtgtctgcgatcttaaat
ggcaatatcaaagtgttattaaatccatggtgttgcaacgtgacaacttgtctgctttgg
gaatcttcatacagcagcgaaattatacctcagatacaaatacaggcagatagtgagagc
ctgtaccttgattttggaccagatcagatcaaaattatgaaaatggtcatccaagattgt
cagttgctcttgagagaactcgcttcattctctgcgagcgagaataaagatgagaagcaa
cttgtgctgtcgaccgagcaacattacaaggacgatctaaaggcaggcgcgtttcagttt
gtcgatggcactgcggacgagctaccttttccgtatcaagtagtattttttgcttatcct
cagcaagcgatggcttggagatatccgcaaccgcgaacgttaacaaggatacatatatct
cctgttccatttgaagccgcagatgtcgacaacagttacatcggcaaaattccttgtgtt
ctcgagtactggagcgacagtcacatgtcgtatcagcgttacgctgagttctacctgtcg
gagacgaattcctaccgattggatctgccagagaaagcgccagcgcgcgcggtagcctgc
gtgtggcgtgtaattattttatccaacagcaagcgaccgctctccaagagcatcgtttct
gcacgtgctctcgcggcctgtctacgcatcgattcctacttcaattctttgataataccg
aatgtacagatcgccttaaatgtcggcgtgctccacgtgtctctgtataatcatatcgac
acgactgtgtataacagtttgccgccaccgttggataggtataccctgaatgggagaatc
cccgaaatacaatgtttcatgtccctggagcaaaaaggagccgtcctggtatttaacaaa
tggaaggataactccatgctgctggatatcaacggtactctgagcatgcacgtgctagat
tacagtcacttaactatgcaagaagtgctagatgccctggagggcagatttcaattgtcg
ttatcggacaaggtggacgcgtcgctgacatgcaatccgttcacgctgaaattggggcca
gcgataacacacacgctcgcggtttccgcccatttgtggctagcatctttcgacgaggag
gagaaaaacgtaattgttctaacgcgctacgtgatcgccaacgacagtaacatctccatc
agatttggtcaaagtggaaccggagataatatacttctggaaagtaggcagtgtaatttc
tactcgtggcggcaaatcggtaaccagatgatacgtatatcaattgaagaaaacgcgtgg
gtgtggagtcgaccttttcccgttaacaaggatggaattcaagtggtggaattcaacaat
ccgacagctaatacaataattttcgtgaacgtcacgtcattctccgcaacacagaaactc
gtaacgttttcggggcaactcgtgattgccaatcaattaattgacaatttcgagatgcgg
ctggtgaaatacgaggccgaagtcggctctcaagtaactgtttcgaaggaggtgtatccc
ataccaagcaaaagcttcccatcatctattgtgctcgaaaataacaggaaaatggctatg
cggctacgtttcacaaacttgacgcatttgtcttggactggagacatacctctgcaacct
aacgttaagtggggccagccctggctcgtgaaagttccgctgcaggaacgcggtcagttt
ctgagcatctgggtgcggatagtaacgcaggtgatacaagacaaagtaaagattcttgcc
gtattgagccctctttatatgattcgatctcacttaccagtaccagcaagggttcagatg
gaaacaccgtcgttaaaaacgtcatcgagcacgacggtgaacggtcgtggtgagcgtcag
caattatattgtccgggtacattcgagcatttccatcagctaacgtttcagttggaatct
ggtgtctccgcgtcgaatccttatgtgccactttcgtacagttccgtggatcaacggaaa
ttctttaggcgacctgaggtcgaggacatcgacaagattctgcaagatctcagggacagg
aaagatgagatgaagtggccgttccaaggtgacgacacggaagagtggatatctgcagag
cagccacagacgcacgtgcaagtgaagtatcaagatgcagggttggtctccagtacatta
ttgctggagctgcaaccgtggtgcttcgtaatgaactcactaggttgtcacatctcgtta
gtgtcagaggatacggagctctgccagattcctcactacggcatagtcacacctcccaaa
ttggagggcacctttcacgtaggcgttggaatcggtgacacttactatacgtcccagacg
ttgcagttggcgcgactagactggagccagagcttctacatgccccgaatctgcggcctt
ataccgttggaagggaacattaaaacgttcgtggattgcggcacaagcgtctccatattg
agcattaattcctccatgtacgaggacatgcgtctggtgcggattacgagtagccacgtg
atcgcaaatctgacatctcaggagttgtgcgtggctacgctcgcggtgcacgagcaggcg
agtgatctgcagctgccccacgatctcactccgtgcagtctgaacattctaccgtctgag
gatcaaaagcagggtacgccaatcgtgcagtggtacacgttgtacacggatagcaatgtc
gagccgctcatgctgtacatatccctcagcctcggtcacagatggtcctgtccgatccga
gtggatcagcctatgagccggaaatccgtcgccattccaaacggttcctcctctatgcca
gttatcgtgacgacgcaagaagacaaaggcatcacgtttatcgtgatacacagcgatgac
catccacagttactgatcgagaacgcttgcggctttaagatcctgctaggtcaagctgat
gagagcggaaatgagatattatcggacagcgctcatttcacgtggatatgcgaggttgac
agcggaggcacgtttcactactcgctgccttgcgtcagtaatagactgcctgacactgct
atcccgagtgcgtcgaatgtgctgttgttctccaccgtgcaaaacgatcaagtggtaggg
aaagggaatttaaaatggtcaagaggcgtaaacctgtccgcgttgtcatctacgccaatg
gatcagtatctgcgactaccctcgtatggtgatgtgaagctcataatgcagagcctctgc
tacaccactctcataagtatcgtacctatctcccaaattgaaatatcggctcaagatatt
agaagcaggctgcaacgaaaaaagaatctggcaaaagattacgatgcaacgtacacaacg
tacccttcttcatcgcgtaggccggaagaagagaaactatcattgcacgtgcaaagctcg
aatagcgcgacatcattgacgagtttcttttctgcccaggaggatatgctatcaacggaa
ggaattgtctcggcatcgagttcaaagcaattaattccgaatatcacgaatactaaaact
tacactgatgaaaatcgattgaggcccaccagcgacgtcaattctaatcctaaagaaggc
tctgtaacggtttacctgcgtacttgtacaatcattattcttcacgacatcaatgaaaac
gcacaaagaatcgaagtcgcgagtctgtctatgacggatttggtcgttaccataaattca
agagctagattcatcaatatgtgttgttatattggcgatctccagttagataatcaatta
ttcgatcagggaggttttgactttcctgtagtgttaataagccagaacccattgccaaat
agagaagtggtatttcatagcagtaattgtttaatgtcgaatatggagaaaatcaaacaa
gattctttgataaccatcgagtatatctgggaagtaaacggaaatataatagcctcgaag
gagtatcgtatgaaaattgcgcccatcagcgcgtacatcgaggacacgtacataacgcaa
ttattggattatgcaacgtcgatgataccaccacgtttggtactgggcgacagtcctaaa
aaaatacaaacgatagctgtgtcaaacgcagtgcacattccggactacattatgatcgat
tccaagattttgagcaaaccgttgagactacaaaattttgtgatagaaccgttgtcaatt
ctgttgagtgttcatacttccgtgcggctctacgtcgccctggatcattctccgttatac
ttcggtacctttgagaggaaaaatctgttgaccactccttacagacttggcaatgcgctt
attatgcattacttatctggagcaatatttggggcaggttgggtggttggatcattggag
atactcggatctccaggaggtttggctcaagcactcggatccggtctcagagacttcgtt
tctctaccatttcaaggattgctacaaggtccttggggttttattgttgggatcacacac
ggatcagctagtctaatgaaacacgtcacagcaggtactgtgaattctgtcacgaaatta
gcatctagcgtcgcacgaaacctggatcgtttgacgttggatgaggaacatcttcagcga
caagaagaatcgcgcagaatgcgtcctcaaggcatggcgcaaggactctatcaaggattg
actggtttcggaatgagcttacttgcggctgtggctggcttggcacatcatcctctgcaa
caagcgtggtcaggcgaagcgacaaccaaaagtttagtcaccggagtcggactcggtttg
gtcggtgtggttactaaaccactgagcggtgccgcagaattggttgcacttacaggtcag
ggcttgctacaaggagctgggtggaatccgttgcctatgccacgccaaagaccaatcgtg
caatacaccaccggcaataatagcacgtccgtgcggtatacctggcgtctatcacctttg
ctcgatcacagtcatgacagtattcttcacgtaaccagcgcagactacgtaatccatcag
ggcagtaatcgcgcagtaacgctcgtcctcacccgacaagctttactgctggttaacatg
gcagaagatagtgtggaacggatattctcgctgaaggaactgacaagcgtcgatcatatc
acggaatcaacgatgttgtgcttatattgtccaccggccgcgacgcaatctagccgaccg
ttgtcgccagctgagcacgagatgaatcaagaaatgagagcgcgagtcgaagaatacgtg
cggactagcagcaccggtttggccagtgtttcaaccaacagtgacagacagtcggatact
ttcgagagaacatccccacatccagaacatacgcttacgttttacgtttgcccggatact
cgtaattacttactgtcgctattcaacattgccaagcgacagaatcaaggctccgggttt
gctgttttataa

DBGET integrated database retrieval system