KEGG   Ooceraea biroi (clonal raider ant): 105283585
Entry
105283585         CDS       T05778                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:obo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105283585
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 105283585
NCBI-ProteinID: XP_011344751
LinkDB
Position
4
AA seq 124 aa
MLAARHRARLTMEERNTHKIRNVRRRLFQDTDDNNDGEGDNFVNRLLEEDRRQKELCKQR
WNFDFEKEEPLPGRYEWVKLDDHRNEIPNSTMINDTVQNPQKQQSEEVESKTSDINETEK
ITNQ
NT seq 375 nt   +upstreamnt  +downstreamnt
atgttggcggcaaggcatagggcccgcctgacgatggaggagaggaatacgcacaaaatt
cgaaacgtgcgtagaagactttttcaagataccgatgacaataacgatggcgagggcgac
aactttgtcaaccggcttttggaagaggatcgaagacaaaaggaactttgtaaacagaga
tggaatttcgatttcgaaaaggaagaaccgctgcctggtcgttacgagtgggtgaaactt
gacgatcacagaaacgaaattcctaattccacaatgataaatgacacggtacaaaatccg
cagaaacaacagtcggaagaggtagaaagtaaaacaagtgatatcaacgagactgagaaa
ataacgaatcaatga

DBGET integrated database retrieval system