KEGG   Ooceraea biroi (clonal raider ant): 105284066Help
Entry
105284066         CDS       T05778                                 

Definition
(RefSeq) glucose transporter type 1 isoform X6
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
obo  Ooceraea biroi (clonal raider ant)
Brite
KEGG Orthology (KO) [BR:obo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:obo02000]
    105284066
Transporters [BR:obo02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   105284066
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    105284066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 BLOC1_2 Baculo_PEP_C DUF948 ISG65-75 Ran-binding NPV_P10 USP8_interact S_4TM DUF1664 Seryl_tRNA_N
Motif
Other DBs
NCBI-GeneID: 105284066
NCBI-ProteinID: XP_011345599
LinkDB All DBs
Position
6
AA seq 623 aa AA seqDB search
MSMNLSAKLDELQRGDRQLETTVALCEIRTQLQELTKSVESCQSEVSEVKRDMVAIKHEL
DTVQQVKEEIEELREYVDRLEESSHRRKLRLLEQLLRCKWPSCCGLTFSLSYSILAAVLG
MLQFGYNTGVINAPEVNIENFMKDVYKDRYGEDISDDSVKKLYSVAVSIFAIGGMVGGFS
GGIIANRFGRKGGLLLNNVLGIVGGCLMGFTKLAESYEMLFFGRFIIGVNCGLNTSLVPM
YISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAVIPAIIQLL
LLPFCPESPRYLLITKQWEEESRKSLRRLRASNQVEEDIEEMRAEERAQQAESTISMTEL
ICSPTLRAPLIIGVVMQLSQQLSGINAVFYYSTNLFTSSGLTDESAKFATIGIGAIMVLM
TLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIKEFFGYVQEMIDWMSYLSVVSTL
SFVVFFAVGPGSIPWMITAELFSQGPRPAAMSIAVLVNWMANFLVGIGFPSMKTSLENYT
FLPFSAFLAIFWIFTYKKVPETKNKTFEEILALFRHGNDRSSLRDSRLYGSMLNCVNALE
GHIPPAESAALMVAEEKPHPDSL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgaacttgagtgccaagctggacgagctgcagcggggtgaccgccagctggag
accaccgtcgctctctgcgagatccgcacgcagctgcaggaactcacgaagagcgtagag
tcttgtcagagcgaggtcagcgaggtgaagcgggacatggttgcgatcaagcacgagcta
gatacggtacagcaagttaaggaggagatagaggaattacgagagtacgtggatcgactg
gaagagagctcccatcgacggaaacttaggctccttgagcagttgctgcgatgtaaatgg
ccatcatgttgcggactgacgttttccctgtcgtattcaatactggcagcagtattgggg
atgttgcagtttggatacaacactggagtgatcaacgcgcctgaagtgaatatagagaat
tttatgaaagatgtgtacaaggataggtatggggaggacatttcggatgattctgttaag
aaattgtactccgtggccgtgagcatattcgcgatcggcggtatggtaggtggtttcagc
ggtggaataattgccaacagatttggcagaaagggaggcttactgctaaacaacgtgctg
ggcatcgtgggggggtgtctaatgggtttcacgaagctcgctgagtcttacgagatgctg
ttctttggacggttcatcatcggtgtcaattgtggcttgaacacctcgttggttcccatg
tacatatcggaaatagcgccattgaacctgagaggtggcctaggcacggtgaaccagctc
gctgttacggtgggtctcctgctctcccaggtgctgggcatcgagcaaatccttggaaca
aacgagggttggcctattctcttaggactagctgtcattcctgccataatacagttacta
ctacttccattttgcccggaatctccaagatatttgctcattactaaacagtgggaggaa
gagtctcgaaaatctttgagaaggttgagagccagtaaccaagtagaagaagacattgag
gagatgagagcggaagaacgagctcaacaagctgagtctacgatctcaatgacggagctt
atatgtagcccaactttaagagcacctctcattattggtgtggttatgcaactttcgcag
cagctttcgggtatcaacgccgtattttattattccacgaatctgttcactagttctggt
ttaacggacgagagtgccaagtttgcaaccattggcataggtgccatcatggttcttatg
acgctagtgtctatcccgctcatggataggacagggaggcgtacattgcacttgtatggt
ctcggtggcatgtttatcttttcaatatttatcacaatttcgtttcttataaaggagttt
ttcggctatgtgcaggaaatgattgactggatgtcctatctctcggtggtgtcgaccctg
agcttcgtcgtgttcttcgccgtggggcccggatcaatcccctggatgatcacggcggag
ctgttctcgcaaggccccagacccgcagccatgtccatcgcggttctcgtcaattggatg
gctaattttttggttggcatcggttttccaagcatgaagactagccttgaaaactacacg
ttcctaccgttcagtgcatttctagccatcttctggatcttcacgtataagaaggttcct
gagaccaagaataaaacattcgaagagattctagctttattcaggcacggtaatgacagg
agcagtttgcgggacagcagactttatgggagcatgctaaactgtgtgaatgcattagag
ggacacataccgccagcagagagcgcagccctgatggtggcagaggagaagccacatcct
gattcattataa

DBGET integrated database retrieval system