KEGG   Ooceraea biroi (clonal raider ant): 105284132Help
Entry
105284132         CDS       T05778                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret isoform X2
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
obo  Ooceraea biroi (clonal raider ant)
Brite
KEGG Orthology (KO) [BR:obo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:obo01001]
    105284132
Enzymes [BR:obo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     105284132
Protein kinases [BR:obo01001]
 Receptor tyrosine kinases (RTK)
  RET family
   105284132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 105284132
NCBI-ProteinID: XP_011345722
LinkDB All DBs
Position
6
AA seq 1210 aa AA seqDB search
MQTAGLQFMSMLRFLLIVMRISVVLGLYFPQSNLTLRFPYVTQYDAKVLPVKLIGLRTLH
NDSVVPQNVEYRLFTTQENIASYQENTSNVMLQSLPKNGALNTIVIEANKKGFGEAVLEI
KVQPVLVKGKTVNCADYIQDMCFWNTSSYRIYENQPVTMIGMFGPEAYRYLCPKFHVRYD
LLNETDYFQILKNKLYANASLDRDTIGPPGGPGPSVDIEVRCVVWEEETGTQHIRMNVLT
IDILDQDDNPPTVQGETTIDIDIDINRLQDFTKGHTLVNAIGKDLILKDADTVISNQYTV
RLLGDTSNALNVTYKILPIEAPNQAPYTAILPKIYVRRTLLPTSPYRVVLQATDVSLLKG
YGPNSVNINITFSGPVHQIPLTVAPSSVITRESLSYPTGVKIVRISPRYLRVAKPTAKPH
PSITFALRGSSAFNVTQREGIVYVANETKLRSESDTVQLKLEWSGANRVVMTRTLRVNLI
NVSKIETCKRSEEETRSCANAETREDCEKSCGIGSGSLSNGSFINRCVWRGNKKRNQMSE
YYSTCSPDLVYCPDNECDELERINPRICPQDCTVESDVLFAHVNSGGRGIKSGMDACSCN
DLLQCTCGLDTFRQQGNKVPGGAKKERLGSGKPRDRENEVARKAFSGPCGPTCMMGVLGS
SLFVLIVIVGSFVTWRYKMAAKSARRECKHRVDDAANGIGILPSDYIDRGDGLLIGLDTF
TAANRHLLLPKTYPPDPKWEFSRSLLKIEQVLGEGEFGRVLRAKAMNIGGVPGPTTVAVK
TLKEDACASELADLLSEYQLLKEAQHPNVIRLLGACTTPPGAPVYLIIEFAEFGSLRNYL
RRNRHLEPESRIPCSMSLVSTSPINPGEEEQQCADNDASNCTITPRDILSFAWQISKGMA
YLADIKLVHRDLAARNVLLATGKVCKISDFGLTRDVYEDDAYLKRSKGRVPVKWMAPESL
ADHVYTSKSDVWSFGVLLWELVTLGASPYPGVDVHNLYNLLKTGYRMEKPPNCSQQLYKL
MVSCWHLEPAMRPSFKELTSHWERMLEDGVEYLDLNPRTVHNQAYFTSLHTLDSANNSGN
DQTDNGTGSNLKTDTVNYLGRMSSEPVTKCDKVDKLQALWQPTVASFPEEAMKSPYVNEQ
PASLNANHYESPIKLRNTSVTSNSENDLRTSTNERPQSYIDMQGKKSSQMEDLLVFSSID
DDKSDNNVTN
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgcaggattgcagttcatgagtatgctgcggttcttgctgatagtgatgagg
atatcggtggtcttaggactctacttcccgcaatcgaacctgactctaaggtttccgtat
gtgacacaatacgacgcgaaggttttaccggtcaaattaattggccttaggaccctccat
aacgactccgttgtaccgcaaaacgtggagtatcgacttttcacgacgcaggaaaatatc
gcatcttatcaggaaaatacgagtaatgtcatgttacagagtcttccgaaaaatggtgct
ctcaatactatcgtcatcgaggcgaacaaaaagggttttggcgaggcagtgcttgaaata
aaagtgcaaccggtactagtaaaaggaaaaactgttaactgcgcggattatatacaggac
atgtgcttctggaacacgtcaagctacagaatttacgagaatcagccagtcaccatgatt
ggcatgttcggcccggaggcgtacaggtacctgtgtccaaaattccacgtcagatatgat
ttattgaacgagaccgactattttcaaatacttaaaaataaattgtacgcgaacgcatcc
ttggatcgagatactatcggtcctccgggaggccctggaccatccgttgatatagaggta
agatgcgtcgtttgggaagaggaaactgggacacagcacatacggatgaacgttcttact
atcgatatcctggaccaggatgacaatcctcccacggtgcagggcgaaactaccatcgat
atagatatagatataaacagactgcaagatttcaccaaaggccatacattggtgaacgcc
atagggaaagacttgatcctgaaagatgcggataccgtgatcagcaaccagtataccgtt
cgtctgcttggtgacacctccaatgcgttgaacgtcacttataagattctgccgatcgaa
gccccgaatcaggcgccttataccgccattctgcctaaaatctacgtcaggagaacgctg
ctgccgacgtcgccgtatcgggtggttcttcaggccacggatgtgtcgcttcttaaagga
tacgggccgaattcggtaaacatcaatataactttttcgggaccggtgcaccaaattccg
ttaaccgtggcgccgtcgtccgtcataacacgggagtcgctgtcatatccgacgggtgta
aaaatcgtcaggatttcaccccggtaccttcgtgtggcgaaacccacggcgaagccacat
ccctcaataactttcgccctgcgtggctcgagcgcttttaacgtcactcaacgagagggc
atcgtttacgtagccaacgagactaaactacgatccgagtccgacaccgtccaactgaaa
ttagaatggagcggagcgaatcgcgtcgtgatgaccaggacgctgcgagtaaatctgatc
aacgtgtcgaaaatcgagacgtgcaagcgatcggaggaagagacgcgttcgtgcgcgaac
gcagagacgcgcgaggattgcgaaaagtcctgtggaattggcagtggatctctgagcaat
ggcagttttattaatcgatgcgtttggagaggcaacaagaaacgcaatcaaatgtcggaa
tattattctacctgctcgccggatctggtttattgtccagacaacgaatgcgacgagctg
gagcgcatcaatccacggatatgtccgcaggattgcaccgtggaatccgacgttctcttc
gctcacgtgaacagtggtggccgcggcataaagagtggcatggatgcctgttcctgtaat
gatctgctgcaatgcacctgcggactcgacacatttcgacaacaaggaaacaaggtgcct
ggtggtgctaagaaggaacgactcggctccgggaaaccacgggatcgagagaacgaggtc
gcacgcaaagcattcagcgggccgtgcggacctacgtgcatgatgggcgtccttgggtcc
agtctatttgtgcttatagtgattgtgggatcattcgtcacgtggagatacaaaatggcc
gcgaagagcgctcgacgggaatgcaaacacagggtagacgatgcggcaaatggtattggt
attttgccgtccgactacatcgatcgcggtgatggtctcctgatcggtctagacaccttc
acggcggcgaatcgtcatctattgctgcccaagacatacccgccggatccgaaatgggaa
ttctcacgatcgctcctgaagatcgagcaagttctaggcgagggtgaattcggacgcgtt
ttgcgcgccaaggctatgaacatcggtggggtgcctggtcccacaaccgtcgcagtgaag
acgttgaaggaggacgcgtgcgcttccgagctggcggatctgctgtccgagtaccagctc
ctgaaggaggcacagcatccgaatgtaatccggttactgggagcctgcacgacgccgcca
ggagcgcctgtctacctcatcatcgaattcgccgaatttggctccttgcgcaactatctg
agacgcaatcgacacttggagccggaaagcagaattccctgctcgatgtctctggtttcc
acctcgccgatcaaccccggcgaggaggaacagcagtgcgccgataatgatgcatcgaac
tgcaccataacgccgcgcgatattctatccttcgcttggcaaatcagtaaagggatggca
taccttgctgatattaagttggtgcaccgagatctcgcggcgaggaatgtcttgctcgcc
accggcaaggtctgcaagatttcagacttcggtttgactcgcgacgtgtacgaagacgac
gcgtacttgaagcgaagcaaaggacgagtgcccgtaaaatggatggcaccggaatccctg
gccgaccatgtgtataccagcaaatcggacgtttggagcttcggcgtgctgctgtgggag
ttggtcacgttaggagcctcgccgtatcccggagtggacgtacataatctctacaatctg
ctgaagactggctatcgtatggaaaagccgcccaattgctcccagcaattgtataaatta
atggtatcttgctggcatcttgagcccgccatgcgaccgtctttcaaggaacttaccagt
cactgggaacgcatgttggaggatggtgtcgagtatctcgatctcaatccacgaactgtt
cataatcaagcctattttacgtctctacataccttggacagcgcaaataattctggtaat
gatcagacggacaacggaactggcagcaacttgaagacggacacagttaactatctcggc
cgaatgtcgtccgagccggtcactaaatgcgacaaggtggacaaactgcaggctctctgg
caaccgaccgtggcatctttccccgaggaagccatgaagtctccctacgtgaacgaacaa
cccgcaagtctgaacgccaatcactatgaaagcccgataaagctgaggaacactagcgtg
acgagcaacagcgagaatgacctcagaacatctactaatgaacgtcctcaatcctacatc
gacatgcaaggaaagaaatcatcgcagatggaagatctcttggtcttcagtagcatagat
gatgacaagagcgacaataacgtgacgaattga

DBGET integrated database retrieval system