KEGG   Ooceraea biroi (clonal raider ant): 105285126Help
Entry
105285126         CDS       T05778                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo00020  Citrate cycle (TCA cycle)
obo00190  Oxidative phosphorylation
obo01100  Metabolic pathways
obo01200  Carbon metabolism
Module
obo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
obo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
obo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105285126
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105285126
Enzymes [BR:obo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105285126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 105285126
NCBI-ProteinID: XP_011347399
LinkDB All DBs
Position
6
AA seq 662 aa AA seqDB search
MSGMLKLSASLLTRGLPGTATLNKLGLPLLSNRKLHHTSDSRAKISDAISKQYPLVDHTY
DAVVVGAGGAGLRAAYGLVAEGFKTAVVTKLFPTRSHTVAAQGGINAALGNMESDNWQWH
MYDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTSDGKIYQRAFGGQSLKFGK
GGQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLLMEDGECRGVIALSLEDG
TLHRFHAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRANLPNQDLEFVQFHPTGIYG
AGCLITEGSRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRSMTMEIREGRGVGPEKD
HIFLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYKGQVL
TKENNQDKVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACAKTIAQENKPGESIG
PLKANAGEETVANLDWVRNANGSISTADLRLTMQKTMQTHAAVFRDAESLREGCRKMTDI
YKKLDDLKVADRSMIWNSDLVETLELQNLMINAMQTIVGAENRKESRGAHAREDHKDRID
EYDYNKPTENQQPKPLDQHWRKHTLSKINPRTGQVSLDYRPVIDVTLDQKECATVPPAIR
SY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcatgctgaagctgtcggcgtcgttgctcacgagaggcttgcccggaacggcg
acgttgaacaagttgggactgccacttctcagtaatcgcaagttgcaccacacatcggac
agccgagcaaagatatctgacgcgatctccaagcaatatccgctggtggaccacacatat
gacgcggtggtagttggtgccggcggagccggtctccgcgcggcctacggccttgtcgcg
gaaggattcaagaccgcggtagtcactaagctgttcccgaccagatcgcacacggtcgcc
gctcagggtggcatcaatgccgccttaggtaacatggagagcgacaactggcaatggcat
atgtacgacactgtcaagggctcggactggttgggtgatcaggacgctatccattacatg
actcgtgaggccccgaaggccgtaatcgagttagaaaactgcggcatgcctttcagccga
acttctgatggcaagatctatcaacgcgcttttggcggccaatcgctcaagttcggcaaa
ggtggtcaggctcaccgatgttgttgtgtggccgacagaaccggtcactctttactgcac
acgctctacggccaatcgttgagctacgactgcaactatttcgtcgagtatttcgcgctg
gacctgctgatggaagatggtgagtgccgtggagtaatcgcgctctccctggaagatggg
acgctgcatcgcttccacgccaaaaacacggttctcgctaccggtggctacggacgcgcc
tacttctcctgcacgtccgcgcacacctgcaccggtgacggcaccgccatggtctccaga
gccaacttgcccaatcaagatctggagtttgtacagttccatcctacaggtatctacggt
gccggatgcttgatcacggaaggcagtcgcggcgaaggcggttatctgataaatagcgaa
ggcgagagattcatggaacgttacgcgccggtagcgaaggacctggcctcgcgagacgtg
gtgtcgcgatccatgacgatggagatcagggaaggcagaggcgtcggaccagaaaaggat
cacattttcttgcagctacaccatctgccgcctgagcagctggccgctcggctaccgggt
atctcagagacggcgatgatattcgcgggcgtcgatgtgacccgtgaacccattccggtc
ctaccgactgtccactacaacatgggtggcgtaccaaccaactacaagggtcaggtgttg
accaaagagaacaatcaggacaaagtggtacctggcttgtacgcgtgcggtgaggcagct
tgcgcatccgttcatggcgctaatcgactaggcgccaactctctgttggacttggtcgtg
ttcggacgagcttgcgctaagactatcgctcaagaaaacaagcctggcgagtcgatcgga
cccctcaaagctaacgctggcgaggaaacagtagctaacttagactgggtcagaaacgcc
aacggctccatttctaccgcggacttgaggctgactatgcaaaaaaccatgcagacgcac
gcggcggtgttcagagacgctgaatccctgcgggaaggttgtcgaaagatgaccgacatc
tacaagaagctcgatgatctgaaggttgcggacaggtccatgatatggaactccgatctc
gtggagacgctcgagctacaaaacctcatgatcaatgcgatgcaaactatcgtaggcgcg
gaaaataggaaggagagtcgcggcgcacacgcgcgcgaggatcacaaggatagaattgac
gagtacgattacaataaaccgaccgagaaccagcagcctaaaccgctcgatcaacactgg
aggaagcacacgctgtcaaaaatcaacccgagaacaggacaggtttctctcgactacaga
ccagttatcgacgttacgctcgatcagaaggaatgcgcgacggtgccgcctgcgattcga
tcctactag

DBGET integrated database retrieval system