KEGG   Ooceraea biroi (clonal raider ant): 105286663
Entry
105286663         CDS       T05778                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo04013  MAPK signaling pathway - fly
obo04214  Apoptosis - fly
obo04215  Apoptosis - multiple species
obo04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:obo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105286663
   04391 Hippo signaling pathway - fly
    105286663
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105286663
   04215 Apoptosis - multiple species
    105286663
SSDB
Motif
Pfam: TNFR_c6 Trp_oprn_chp CD225
Other DBs
NCBI-GeneID: 105286663
NCBI-ProteinID: XP_026829014
LinkDB
Position
10
AA seq 329 aa
MPRESCSGLLLTLVSVFVGLCESSAAGGATSSAQQQQQQQQQQQHPVCKPGLEFWSADRA
ACWPCTRCAPEFTLSPCAVHKDAICGPFSALELDWSFLSSTRKSVPPEAGDGSQRRLEET
VTSKMFWRFPEKQTKERPVEEAGNLVDLDREKNESSIDEEPVSASPESKTAHDPRERRKS
PGEDNLLWDWQTVALVLAVCACIVFFLVAGCSALIYARQWRRMKKNFEPAGLEEISARLN
LMVKAELAELVAGAPMNPGDPETRCQYLEKLLGKHGQNFKALIRSHKFPRRPPLDLTICE
HRLLTLTRFLICIYGDISNTQFGKIVICP
NT seq 990 nt   +upstreamnt  +downstreamnt
atgccgagggaatcttgctccgggctgctgttgaccctggtgtcggtattcgtcggcctg
tgcgaatcctctgccgccggcggcgcgacatccagcgctcagcagcagcagcaacagcag
cagcaacagcaacatccggtctgcaaacccggcctggaattctggtctgccgatcgcgcc
gcctgctggccgtgcacccgatgcgccccggaattcaccctgagcccgtgcgctgtgcac
aaggacgcgatttgcggcccgttctcggcgctcgagctcgactggtcctttctgtcgtcg
acgagaaagagcgtcccgccggaggctggcgatggcagccaacgtcgcctcgaggaaacc
gttacgtcgaagatgttctggcggtttcccgagaaacagacgaaagagcgacccgttgag
gaagccggcaatctcgtcgacctcgatcgagaaaagaatgaaagttcgatcgacgaagag
ccggtctccgcctcgccggaatcaaaaacggcacacgatcctcgggagaggagaaaatct
cccggcgaggacaacctactgtgggattggcagactgttgcgttggtcctcgcggtttgc
gcctgcatagtattcttcctggtagcgggatgctcggctctcatctacgcaagacagtgg
cggcggatgaagaaaaactttgagccggcgggtctcgaggagatctcggccagattgaac
ctgatggtaaaggcggaactggccgaactggtcgcaggagctccgatgaacccaggcgat
cccgaaaccagatgtcagtatctcgagaagcttttaggtaagcacggtcagaattttaag
gctctcattcgcagccataaattcccacgacgaccaccacttgatttgaccatctgtgag
catcggttactgactcttacgagattcttgatatgcatttatggagacatatcgaatact
caatttggcaaaattgtcatctgtccataa

DBGET integrated database retrieval system