KEGG   Ooceraea biroi (clonal raider ant): 105286865Help
Entry
105286865         CDS       T05778                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo00040  Pentose and glucuronate interconversions
obo00051  Fructose and mannose metabolism
obo01100  Metabolic pathways
Module
obo_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    105286865
   00051 Fructose and mannose metabolism
    105286865
Enzymes [BR:obo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     105286865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Pyr_redox_2 ADH_zinc_N_2 Methyltransf_16 Homoserine_dh UDPG_MGDP_dh_N 2-Hacid_dh_C Pyr_redox Phosphonate-bd
Motif
Other DBs
NCBI-GeneID: 105286865
NCBI-ProteinID: XP_011350423
LinkDB All DBs
Position
1
AA seq 350 aa AA seqDB search
MARENLAAVLYGINDLRLENTSIEEPEDDEVLLEMGCVGICGSDVHYLVNGRIGDFIVKK
PMIIGHESSGTVTKLGKNVKNLKVGDRVAIEPGVPCRVCKFCKEGRYNLCKEIVFCATPP
VHGSLRRFYKHAADFCFKLPDHVSLEEGALLEPLSVGVHACKRAGIGIDSKVLILGAGPI
GLVTLLVAKAMGANKVVITDIIENRLNMAKKLGADATYLVQKDRSEKDVVADIHRIFGDE
PNRTIDASGAQASIRLAILATRSGGMVVLVGNSAPEVQIPLINALTREVDIRGIFRYAND
YGDALELVASGKVNVKPLITHNYKIEETKQAFETSKTGAGGAIKVMIHCK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggctcgggagaatcttgccgctgtgctgtacggcatcaacgatctgcgcctggaaaat
acgagtatcgaggaaccagaagacgatgaagtacttctggaaatgggatgtgttggaatc
tgcggatcagatgttcattatcttgttaatggaagaattggtgatttcatagtgaagaaa
cccatgataattggtcacgagtcttccggtacagttactaaacttgggaaaaatgtcaag
aatctgaaagtgggggatcgcgttgctattgaacctggtgtgccttgcagggtatgtaag
ttttgcaaggagggacgttacaatctgtgcaaggaaatcgtgttttgcgcgacgccgcct
gtgcatggtagcctaagacgtttctacaaacacgcagctgatttttgcttcaaattgccc
gatcatgtgagtttggaagaaggagcgcttttggaaccgttgtcagtgggagtgcacgct
tgcaaacgggccgggattggaatcgattctaaagttttaatcctaggagctggtccaatc
ggtctggtgacgttattggtggccaaagctatgggtgcgaacaaagtagttatcacagat
atcatagaaaatagactgaacatggcgaagaaactcggcgccgatgctacatatttggtg
caaaaagatagatcggagaaggatgtagtggctgatatccatagaatttttggagatgaa
cctaacagaacaatagacgcctctggtgcgcaagcctcgattcgcttggcgattctcgca
acaagatctggaggaatggtggtattagtgggaaatagtgccccagaggtgcagatccca
ttaatcaacgcgttgactagggaagtcgatattcgaggcatttttcgttatgcgaatgac
tatggtgacgcactggaactcgtcgcatctggcaaggtgaatgtgaaaccattgatcact
cacaattacaaaatagaggagaccaagcaagcgttcgagaccagcaaaactggggcgggc
ggagccatcaaagtcatgattcactgcaaatag

DBGET integrated database retrieval system