KEGG   Oryza brachyantha (malo sina): 102699849Help
Entry
102699849         CDS       T02995                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
obr  Oryza brachyantha (malo sina)
Brite
KEGG Orthology (KO) [BR:obr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:obr01001]
    102699849
Enzymes [BR:obr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102699849
Protein kinases [BR:obr01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   102699849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo Pkinase_C APH FTA2 RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102699849
NCBI-ProteinID: XP_006650044
UniProt: J3LNI0
LinkDB All DBs
Position
3
AA seq 480 aa AA seqDB search
MVSSEISSVTTTHAQGPKLFRGKILLPMGPPDVVPSENIEFDFSDVFGSTAVQTPTDLSI
LTPDSPAPLAESNEGIYNDPVVIVKRSHSLVGPSSLVSQSLPISKLTLHGSDSSLDLLDC
PKEKQGNQGALSDEELDNTEKENGIFGLEDFEVLKLVGQGAFGKVYQVRRKGTSEIYAMK
VMRKDKILEKNHAEYMKAERDILTKVDHPFVVQLRYSFQTKYRLYLVLDFINGGHLFFQL
YQQGLFREELARIYTAEIVSAVAHLHANGIMHRDLKPENILLDADGHAMLTDFGLAKEFD
ENTRSNSMCGTVEYMAPEIVQGCGHDKAADWWSVGILLFEMLTGKPPFVGGNRDKVQQKI
IKEKIKLPAYLSSEVHSLLKGLLHKEAGRRLGSGPGGSNEIKNHKWFKLVNWKKLDARQI
QPSFRPNVAGKTCIANFDECWTSMPVLDSPVASPVAADSNFVGFSYVRPAPFLQRPSPLG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctctgaaataagctctgttacaacaacccatgcacaaggtcccaagctcttt
agagggaagatacttctgccaatgggccctccagatgttgtgccttctgaaaacattgag
tttgatttctcagatgtttttggttctacagcagtccagactcccacagatctgagcatt
ctcactcctgacagtcctgcacctttggctgagtccaatgaggggatttacaatgaccct
gtggttattgtcaagagatctcattctcttgttggtccaagttcacttgttagccaatcc
ttgccaattagcaaacttacactgcatggatctgatagctcattggacctgctggattgt
cctaaagaaaagcaaggtaaccaaggagctcttagtgatgaagagcttgataatacagaa
aaggagaatggtatttttggacttgaagactttgaagtcctgaagcttgttggccaaggg
gcatttggaaaggtatatcaagtgaggaggaaaggcacttcagaaatatatgcaatgaaa
gttatgaggaaggacaagattttggagaagaaccatgctgagtacatgaaagcagagaga
gatatactgactaaagtcgatcatccttttgtagtacagctgaggtactcctttcagaca
aaataccgactttaccttgtgttggacttcataaatgggggccatcttttcttccagctt
taccaacagggcttgtttagggaggagcttgcacgcatctacacagctgaaattgtatct
gctgtagcccacctccatgcgaatggaattatgcacagggatctgaagccagagaacatc
ttattggatgctgatggacacgccatgttgactgattttgggctggcaaaggaatttgat
gaaaacactagatcaaactcaatgtgtggtactgttgagtacatggccccagaaattgtt
caaggctgtggtcatgataaggctgcagactggtggagtgtgggaatccttctgtttgaa
atgcttacaggaaagcctccatttgttggtggaaacagggacaaagttcagcagaagata
attaaggagaaaattaagcttccagcatatttatctagtgaagttcattcgttgctcaaa
ggcttactgcacaaagaagctggcaggaggctgggaagtggaccaggcgggagcaatgaa
ataaagaatcacaaatggttcaagttagtaaactggaagaaactagatgcccgacagatc
cagccaagcttccgcccaaatgttgctggcaaaacctgcatcgcgaactttgacgagtgc
tggacgagcatgcccgtgctggactctccagtggccagccctgtcgctgcagatagtaac
ttcgtgggattcagctatgtgaggccagcgcccttccttcagaggccgagtcctctaggc
tga

DBGET integrated database retrieval system