KEGG   Oryza brachyantha (malo sina): 102699894Help
Entry
102699894         CDS       T02995                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00020  Citrate cycle (TCA cycle)
obr00190  Oxidative phosphorylation
obr01100  Metabolic pathways
obr01110  Biosynthesis of secondary metabolites
obr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102699894
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102699894
Enzymes [BR:obr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102699894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_18 Fer4_7 Fer4_16
Motif
Other DBs
NCBI-GeneID: 102699894
NCBI-ProteinID: XP_006660579
LinkDB All DBs
Position
9
AA seq 186 aa AA seqDB search
RGAICGSCSMCIDGVNTVACLKPVDTGTSAATTVTPLPHMYVVKDLVVDLTSFYQQYKSV
EPWLKRKSKTKTTEGGLREHAQSPEERKKLDGLYECILCACCSTACPSYWWNSEAFLGPA
ALLHAYRWVSDSRDEYGAERVQALAEGWDKLYRCRMIKSCTATCPKSLDPAAAISAMKTL
HQLGKP
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
cggggggccatctgcgggtcctgctccatgtgcatcgacggggtgaacaccgtcgcgtgc
ctcaagcccgtggacaccggcacgtcggcggccacgacggtgacgccgctgccccacatg
tacgtggtcaaggacctcgtcgtcgacctcaccagcttctaccagcagtacaagtcggtg
gagccgtggctgaagaggaagtcgaagacgaagacgacggaaggggggctgcgggagcac
gcgcagtcgccggaggagaggaagaagctggacgggctgtacgagtgcatcctgtgcgcg
tgctgcagcacggcgtgcccgtcgtactggtggaactccgaggcgttcctggggccggcg
gcgctgctgcacgcgtaccggtgggtgtcggacagccgcgacgagtacggggcggagcgg
gtgcaggcgctggcggaggggtgggacaagctctaccgctgccggatgatcaagagctgc
accgccacctgccccaagagcctcgaccccgccgccgccatctccgccatgaagaccttg
caccagctcggcaaaccgtga

DBGET integrated database retrieval system