KEGG   Oryza brachyantha (malo sina): 102700016Help
Entry
102700016         CDS       T02995                                 

Definition
(RefSeq) DNA ligase 1
Organism
obr  Oryza brachyantha (malo sina)
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DRMBL UBA_4 RMMBL
Motif
Other DBs
NCBI-GeneID: 102700016
NCBI-ProteinID: XP_006646213
UniProt: J3L2Z7
LinkDB All DBs
Position
1
AA seq 1397 aa AA seqDB search
MAYLFSSPDSKSLSITTSTLFLSSLASLPNETPSTSAASPLSPVPASVPATALIPGSRFL
VDAFRHAGDYSVSYFLSHFHSDHYVGLGPSWRRGLVFCSAITARLLVSVLSVPPQLVVVV
DVGTHVNVDGWGVVAVDANHCPGAVQFLFRSSGPNAERYVHTGDFRFSQSMRTERNLLEF
IGADAVFLDTTYCNPKFTFPSQEESLDYVVNTIKRVKDERGAAGERVLYLIATYVVGKER
ILLEVARRCGCKIHVDSRKMEILTVLGIGGENGVFTEDAAATDVHVTGWNILGETWPYFR
PNFVKMNEIVVERGYNKAVGFVPTGWMYETKKEGYAVRAKDSLEIHLVPYSEHSSYDELR
DYVKFLHPKRVIPTVGLDGGKLDSKEAFALQKHFTCLVDETANKQEFLMAFHRKSRSVSL
GPEDAVTRLSQQEMEEATLLPAISPALERSDNLQEKITVEMKKDLSDFLPSWVSQDLILD
LLIKSGGDVVQAATDFFEKERDFFEQANVSNSETPKSEINLTDHGSSVDASSQQEVPLFS
QKPMDQQKKLINLNSMRMKSNPPKRERKRGSNSADKPKKKGRSIASKPSTESSGRKQSTI
TNYFVRTITTASKSDMSDEVTVDANQSNVKNGDQFTDLVESEKQSVSQLLQIIDGGISRE
SAISLLEKAKGDVNVAVDIFYSKTDSSDVDENDKNIAVKNIENDMSDKSSNKSMLCNSSE
ATPKMPNLCVQSYVTQAESVSISLPIEKYVPIEHACWTAGQSAPYLHLARTFDLVEREKG
KIKSTAMLCNMFRSLLALSPDDVLPAVYLCTNKISPDHENIELNIGGSLVVSALEEALGS
SRSKIHEMYKTYGDLGDVAQECRQNQMLLAPPRPLSICDVFSTLRKLSAISGSGSTGRRK
ALVLHLIRSCREMEMKFLVRTLVRNLRIGVMMKTILPSLAHAVVIDGKYSNSPVLSLEGI
KLQLQELSAEVAEAYNVIPNLDLLIPSLLREGTAFSASSLAMVPGTPIPPMLARITNGVT
QSLKLFHGRAFTCEYKYDGQRAQIHRSNDGSVQIFSRQMKESTSRFPDVVNMIKELCSIE
VSSFIIDTEVVGIDRKKGNKLMSFQELSSRERGSKHSSIAIQNIKVDICVFVFDIMFCNG
KRLLNCPLRERRKYINELFQEKPGHFELAQQLTVEADEAYVDNSTTLDRMNTFFKMACHS
SCEGIMLKTLDVDAGYSASKRCDSWLKVKRDYVEGLGDSLDLVPIGAWYGNGRKAGWYSP
FLMACYNPEYEEFQSVCRVMSGFSDEFYKEMKEFYSGDRILPKKPVYYKTDELPELWFSP
EQVWEIRGADLTLSPVHHAAIGLVHPSRGISVRMPRYICSRPDRSPDDCSTACDVASLFK
AQTRKMEVSSDAQDTIH
NT seq 4194 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacctcttctcctccccggactccaaatcgctctcgatcaccacctccaccctg
ttcctatcgtcgctcgcgtccctccccaacgaaaccccctctacctccgccgcgtccccg
ctctcacccgtccccgcctccgtgccggctactgcgctcatccccggctcccgcttcctc
gtcgacgccttccgccacgccggcgattactccgtctcctacttcctctcccactttcac
tccgaccactacgtcggcctcgggccctcctggcgccgtggcctcgtcttctgctccgcc
atcaccgcgcgcctcctcgtctccgtgctctctgttccgccgcaactcgtcgtcgtagtt
gatgttggtacccacgtcaacgtagatgggtggggcgtcgtcgctgtggatgctaaccat
tgtcctggtgccgttcagttcctcttccgctcatctggaccaaacgcggagaggtatgtc
cacaccggtgatttccggttttctcaatctatgaggaccgaacgtaatttgctggagttc
atcggtgctgatgctgtatttctagataccacgtattgcaatcccaaattcacatttcct
tcacaagaggagtcactggattatgttgtgaacacaatcaagcgggtgaaagatgagaga
ggagcagctggagagcgtgtgctatatttgatcgcgacctatgttgtgggcaaggagagg
attttgctggaagttgcacgacgctgtggctgtaagatccatgtggacagtaggaagatg
gagattttgactgtgttggggattggtggggagaatggagtttttactgaggatgctgca
gcaacagatgtgcatgtcactgggtggaatattttaggtgaaacatggccctatttccgg
ccaaattttgtgaagatgaatgagatcgtggtggagagaggatacaacaaggctgttgga
tttgtaccaaccggctggatgtatgagaccaagaaggaagggtatgcagttagagcgaag
gattcacttgagatccatcttgtaccttatagtgaacactcaagctatgacgagttgcgg
gactacgtgaagttcttgcacccaaaacgggtaattccaactgtgggacttgatggtgga
aagctcgatagtaaagaggcatttgctctgcagaagcattttacttgcttagtggatgag
actgcaaacaaacaggaattcctgatggcattccaccgaaaatcaagaagtgtttctctt
ggccctgaggatgcagttactagattgagccagcaagaaatggaggaggctactttgtta
cctgcaataagtccagctcttgagcgatcagataatttgcaagagaaaattacagtggaa
atgaagaaagatttgtcagatttcctaccctcatgggtcagccaggatctaatcttggac
ctgctaattaagtcaggcggtgatgttgttcaagcagcaactgatttttttgagaaagaa
agagatttctttgagcaagcaaatgtttctaatagtgaaacgcctaagtcagagataaat
ctcactgatcatggatcatctgttgatgcaagtagtcagcaagaagttcccttattttca
cagaagcccatggatcaacaaaaaaagctgattaatttgaactctatgagaatgaagtca
aatcctcctaaaagggaaagaaagaggggctctaattctgcagacaagccaaaaaagaaa
ggacggtcaattgcctcaaaaccctcaacagaatccagtgggcgcaaacagtccacaatt
acaaactattttgttagaactatcacaactgcttctaaaagcgatatgtccgatgaagta
accgtggatgcaaatcaaagcaatgtgaagaatggtgatcagtttactgatcttgtagag
tcagagaagcagagtgtaagccagcttcttcagattatagatggtggcatttcaagagaa
tctgcaatttctttacttgagaaggcaaaaggggatgtgaatgtggcagttgatatattt
tacagtaaaactgacagcagtgatgtagatgaaaatgataagaatattgccgtaaaaaac
atagaaaatgacatgtcagataaatctagtaataaaagcatgctttgcaactcttctgag
gctactccaaagatgccaaacttatgtgtacaatcttatgtaacacaagcagaatcagtc
agtatatcattgccaattgaaaagtatgtacccatcgagcatgcttgctggacagcagga
cagtctgcaccgtacttacatttggctcgcacttttgatctggttgaaagagaaaaggga
aagatcaaaagtactgccatgctttgtaacatgttccgaagtttgcttgccttatcacct
gatgatgtgctacctgctgtttatttatgtactaataaaatttctcctgaccatgaaaat
attgaactaaacattggtgggagtctggttgtatctgctctggaggaggcattaggatcg
agcagatctaaaatacatgagatgtacaaaacttacggtgatcttggtgatgttgcccaa
gaatgccgccagaatcaaatgttacttgctcctcctcgtccactttcaatttgcgatgtg
ttttccacacttcgcaagctaagtgcgatatcaggtagtgggagtactggaaggagaaag
gctcttgtcttgcatcttattcgttcttgcagagaaatggagatgaagtttcttgttaga
acactggtccgtaacttgcgtattggggttatgatgaaaacaattttaccttcacttgca
catgctgttgttattgatggaaaatattcaaatagtcctgtgctatctttggaaggcata
aaattacaactacaggaactttcagctgaagttgctgaggcatacaatgtcattcctaat
cttgatttgcttattccctctcttctgagagaaggcactgcattttcggcttcatcgtta
gcaatggtacctggcacccctatcccacctatgcttgcaagaattactaatggggtgact
caatcgctgaaattgtttcatggtagagcatttacctgtgaatacaagtatgatggtcag
cgagcccagattcaccgatcaaatgatggatctgtgcaaatattttcaaggcaaatgaag
gagtcaacctctcgatttcctgatgtagttaacatgatcaaagagctgtgcagcatagaa
gtgtccagctttataattgacactgaggttgtgggaatcgatagaaagaaaggaaacaag
ctgatgtcgttccaagagctgtcttcaagagaaagagggagcaagcactcctcaattgca
attcagaacataaaggtggacatttgtgtttttgtttttgatattatgttctgcaatgga
aaaaggctactgaattgcccacttcgggaaagaagaaagtacatcaatgagctttttcag
gagaagccaggacattttgagttagctcagcagcttactgtagaagcagatgaagcttat
gtggataattctaccactttggacagaatgaacacctttttcaaaatggcatgccattct
tcttgtgagggtattatgctgaaaacactggatgttgatgctggatactctgcgtccaag
cgctgtgattcatggttaaaggttaagcgtgactatgttgaaggcttaggtgatagcctg
gacttggttccaattggtgcatggtatggaaatggccggaaagctggatggtatagccct
ttccttatggcatgctacaaccctgaatacgaagaattccaaagtgtctgccgtgttatg
tctggtttctcagatgagttctataaagagatgaaggagttctattctggagacagaata
ctgcctaagaaacctgtctactacaaaacagatgaacttccggaattgtggttttctccg
gaacaagtttgggaaatccgaggtgcagacctcacgctatcccctgttcaccatgcggct
attggtctggtccatccgtcgcgtgggatctcagtgaggatgccgaggtacatatgctct
cgtcctgatcggagcccagatgactgtagcacggcttgtgatgttgctagcttgttcaaa
gctcagacccggaagatggaggtcagcagcgatgcccaggacacaattcactag

DBGET integrated database retrieval system