KEGG   Oryza brachyantha (malo sina): 102700561Help
Entry
102700561         CDS       T02995                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr03030  DNA replication
obr03410  Base excision repair
obr03420  Nucleotide excision repair
obr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:obr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102700561
   03410 Base excision repair
    102700561
   03420 Nucleotide excision repair
    102700561
   03430 Mismatch repair
    102700561
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:obr03032]
    102700561
   03400 DNA repair and recombination proteins [BR:obr03400]
    102700561
Enzymes [BR:obr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102700561
    6.5.1.6  DNA ligase (ATP or NAD+)
     102700561
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102700561
DNA replication proteins [BR:obr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102700561
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102700561
DNA repair and recombination proteins [BR:obr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102700561
   NER (nucleotide excision repair)
    Other NER factors
     102700561
   MMR (mismatch excision repair)
    Other MMR factors
     102700561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 TrmB ORC5_C
Motif
Other DBs
NCBI-GeneID: 102700561
NCBI-ProteinID: XP_015697493
UniProt: J3N3L6
LinkDB All DBs
Position
10
AA seq 650 aa AA seqDB search
MDAPKSEERDTTLELKKKGSEFDPMAAAYWKPGEPVPFLFLARALDLISNESGRIVITEI
LSNVFRTVIATTPDDLLATVYLSANRIAPPHEGTELGIGDASIIRALSEAYGRKEEHVKK
NLKELGDLGLVAKASRLSQKMMYKPKPLTISRVLATFRTIAKESGKDSQDKKRSHIKGLL
VAATDCEPQYIIRLLQSKMRIGLAEKTVQMALGQAAVHSENHSPPSKIQSPFEEAAKIIK
QVYSVLPIYDKIVPALLEVGVWKLPEICSFSIGVPVGPMLAKATKSVSEIIDKFQGVGYT
CEYKYDGERAQIHCMEDGSVEIYSRNAERNTGKYPDVVDAVSRFRKPTVKSFVLDCEIVA
YDREKKKILPFQILSTRARKAVTINDIKVSVCTFGFDILYINGKPLLQEQLKVRREHLYN
SFEEVPGVFQLATAITSNDLEEIQKFLDTAVNSSCEGLIIKTLDKDATYEPAKRSNNWLK
LKKDYMDSIGDSLDLVPIAAFHGRGKRTGVYGSFLLACYDEQNEEYQTICNIGTGFSEQQ
LEERSVSLRTKVITKPKAYYRFADSMDPDVWFEPSEVWEVKAADLSISPVHRAANGIVDP
NKGISLRFPRLLRVRDDKNPEQATTSEQVADMYRAQKIHHANNNDDEDDD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggatgcccccaagtctgaggagagagataccacccttgagctcaagaaaaaaggcagt
gaattcgatcctatggctgctgcttattggaaacctggggagcctgtgccctttctgttt
ctggctcgggcacttgatctcatctctaatgagtctggaaggattgttatcacagagata
ctatcaaacgtgttccgcacagtgattgctacaacaccagatgatctccttgcgacagta
tacctctcagccaatcggattgcgccgcctcatgaaggaactgagcttgggatcggggac
gcgtcaatcatccgtgctctttcagaggcatatggccgcaaagaggagcatgtcaagaag
aacctcaaggagctcggtgatttgggtcttgttgcaaaagcaagcaggttgtcacagaag
atgatgtacaaaccaaaaccactgacgatatctcgtgtgcttgctacttttcggacaatt
gcaaaggaatcaggcaaagatagtcaagacaagaaaagaagtcatatcaaaggacttctc
gttgccgcaactgactgtgaacctcaatacattatacgcctacttcagtcgaagatgagg
attgggttagctgaaaaaactgtccagatggctcttgggcaagctgctgtgcattctgaa
aaccattctccgccatcgaaaattcaatcaccttttgaagaggctgcaaaaataattaaa
caagtatattcggttcttccaatatatgataaaatcgtcccagctcttcttgaagttggt
gtttggaaacttccggagatatgcagcttttctattggtgtccctgttggtcctatgttg
gcaaaagcaacaaagtctgtctcagagatcattgacaaatttcagggtgttgggtacact
tgtgagtacaagtatgatggtgaacgggctcagatacactgcatggaggatggatcagta
gagatctacagtcgtaatgctgaaaggaacactgggaagtatcctgatgttgttgatgca
gtttctagattccggaaacctactgtcaaatcatttgtcttggactgtgaaattgttgct
tatgaccgtgaaaagaagaaaattttaccttttcagatacttagcacaagggcccgcaag
gctgttaccataaatgatatcaaagtttcagtctgtacttttggctttgatattctttat
atcaatgggaagcctcttctccaggaacagctgaaagttcgtcgagagcatctttacaac
tctttcgaggaagtaccgggcgtttttcagttggcaactgcaattacatcaaatgacctt
gaggagatacaaaaatttcttgatacggctgttaactccagttgtgaagggttgattatc
aagacattggataaggatgctacgtatgagccagcaaaacggtcgaacaattggttgaaa
ttgaagaaagactacatggacagcattggggactctttggatttggtgccaattgctgcc
ttccatgggagaggaaaacgaacaggtgtatatggatcattcctcttggcgtgttatgat
gagcagaatgaagaataccaaacaatctgcaacataggcactggattttctgaacaacag
cttgaggagcgttctgtgagtcttcgaactaaagtgataacaaaaccaaaggcatactat
aggtttgctgattcaatggacccggatgtgtggtttgagccttcagaggtgtgggaggtg
aaagctgccgatttgagcataagtcctgttcatcgtgctgctaatggtatagttgatcca
aacaagggtatctctctaagatttcctcgtctgttgcgtgtacgtgatgataaaaaccca
gagcaagcaaccacatccgagcaagttgctgatatgtaccgtgctcaaaaaatacaccat
gcaaacaataacgatgatgaggatgatgactga

DBGET integrated database retrieval system