KEGG   Oryza brachyantha (malo sina): 102700821Help
Entry
102700821         CDS       T02995                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:obr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102700821
Enzymes [BR:obr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102700821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu SEEK1
Motif
Other DBs
NCBI-GeneID: 102700821
NCBI-ProteinID: XP_006659705
UniProt: J3MVC4
LinkDB All DBs
Position
8
AA seq 199 aa AA seqDB search
MAAQTLLFSATALFQSPSSARPFHPLRLVAGPGGAAAARALVVADATKKAVAVLKGTSQV
EGVVTLTQEDEGPTTVNVRVTGLTPGLHGFHLHEFGDTTNGCISTGPHFNPNNLTHGAPE
DEVRHAGDLGNIVANAEGVAEATIVDSQILLTGPNSVVGRAFVVHELEDDLGKGGHELSL
STGNAGGRLACGVVGLTPL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcagaccctcctcttctccgccaccgccctcttccagtccccttcctctgct
cgccctttccacccgctccgcctcgtcgccggccccgggggcgccgccgctgccagggcg
ctcgtcgtcgccgacgccaccaagaaggccgtcgccgtgctcaagggcacctcccaggtc
gagggcgtcgtcacactcacccaggaagacgaaggtcctacaacagtcaacgttcgtgta
acaggacttactcctggacttcacggcttccaccttcacgagtttggcgatactacaaat
gggtgcatatcaacaggaccacattttaacccaaacaatttgacgcacggtgcaccagaa
gatgaagtgcgtcatgcgggtgacctgggaaacattgttgccaatgctgaaggggtagct
gaggcaaccattgttgatagccagattcttcttaccggaccaaattctgttgttgggaga
gcattcgttgttcatgagcttgaagatgatttggggaagggggggcatgagcttagcctc
agtactggaaatgccggtgggcgacttgcatgtggtgtcgttggcctgaccccgctgtag

DBGET integrated database retrieval system