KEGG   Oryza brachyantha (malo sina): 102703333Help
Entry
102703333         CDS       T02995                                 

Definition
(RefSeq) WD repeat and HMG-box DNA-binding protein 1
  KO
K11274  chromosome transmission fidelity protein 4
Organism
obr  Oryza brachyantha (malo sina)
Brite
KEGG Orthology (KO) [BR:obr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:obr03036]
    102703333
Chromosome and associated proteins [BR:obr03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    102703333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40 eIF2A IKI3
Motif
Other DBs
NCBI-GeneID: 102703333
NCBI-ProteinID: XP_006661046
UniProt: J3MVR2
LinkDB All DBs
Position
9
AA seq 1017 aa AA seqDB search
MKGRVVKLREAHKAGSPAFCSVAWGQRGQHLVTASAADVAILIHEAAAAGGRGSGSAAAA
AVSTIRLHKDGVTALAVAPGSGGSLASGSIDHSVKFYSFPEGAFQSNVARFTLPIRSLAF
NKKGTLLAAAGDDDGIKLIATIDNTISKVLKGHKGSVTGLSFDPRNDYLASIDTFGTVIF
WDLCTGNEARSLKRIAPAFGSDHSVNNALCWSPDGQFLAVPGLRNNVVMHDRDTGEEVFT
LKGEHEQPVCSLCWSPNGRYLVTAGLDRQVLIWDVKSKQDVERQKFDERICSLAWKPEAN
AVAVIDVTGRFGIWESVIPSTLKSPTEGAPDLNSTKIPLFDDEDDDEKPSTSGGLEDDVD
ESLGESGPFNHKRSRRKSTFHGHSNGDSEDEDLILQMESRKRIKDITHRDNKGVTTDKTR
GDSATSGKLVTARMQTAFQPGSTPPQPGKRNFLAYNMLGSITTIENEGHSHVEVDFHDTG
RGPRVPSMTDYFGFTMAALNDSGSVFANPCKGDKNMSTLMYRPFSSWAGNSEWSMRFEGE
EVKAVAVGNGWVAAVTSLNFLHIFTEGGLQMHILSVNGPVVTAAGHGDQLAIVSHASDCL
SSGDQVLDVKVLKISECAQSLSSRLVLSPSSQLSWFGFSENGELSSFDSKGILRVFSGQF
GGSWIPIFSSIKARKSEDESHWVVGLDANNIFCILCKSHEYYPQVTPKPVLTIFELSFPV
ASSDLGATSLENEFVMRKLHLSQTQKKIEEMAALGLDTTALDDEAFNMEAALDRCILRLI
SSCCNGDKLVRASELAKLLTLEKSMKGALMLVTRLKLPILQEKFSSILEERMLNDAKIVK
TTGVLSNTNTNYPPSLAFSTQAVAPAKVVQNGNSLKLSTLPELNPATQQRNPSESNKAEV
EHGTQSKERSLKVSPLQAPLAKIQKNGENVAIKTKKDKDGSSHATTVDQNPKGGIHQVAL
KNMSTDDCSGLQPQRPVNPFAKSSSSKEQPSSVFDSIKKMKVENDKVDKADSKKVKV
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggccgggtggtgaagctccgggaggcgcataaggccggctcgccggcgttctgc
tccgtcgcgtggggccaacgcgggcagcacctcgtcactgcctccgccgccgacgtggcc
atcctcatccacgaagccgccgccgccggtgggcggggctcgggttcggcggcagcggcc
gcggtttccacgatccggcttcacaaagatggcgtcacggcgctcgccgtcgcgccaggc
tccggcgggtcgctggcgtccggatccatcgaccactccgtcaagttctactccttccca
gagggggcgttccagagcaatgtcgcgcggttcaccctgccgatccggtcactcgccttc
aacaagaaggggactcttctggcggcggccggagacgacgacggcatcaagctgatcgcg
acaatcgacaacaccatctccaaggtgctcaagggccacaagggatcggtaactggcttg
tctttcgatcccagaaacgattatctggcatccattgataccttcggcacggtcatcttc
tgggatctctgcacggggaatgaagcccgcagcttgaagcgtatcgcgccggcatttggt
tcagatcactcggtcaacaatgcattgtgctggagccctgatgggcagtttcttgctgtt
ccggggctgaggaataacgtggtcatgcatgatagggacacaggcgaggaggtgttcacc
ctgaaaggggagcatgagcagcccgtgtgtagtctctgctggtctcccaatgggaggtac
ctggtcactgctggcttggataggcaggtgctgatctgggatgtcaagtccaagcaggac
gttgagaggcagaaattcgacgagaggatatgcagcctggcttggaaacctgaggcgaat
gctgttgcagtgatcgatgtgaccggcagatttggcatttgggaatcggtcatcccgtcg
actttgaagtcacccactgagggtgcacctgatctgaactcgaccaaaattcctttgttt
gatgacgaggacgacgacgagaagccgagtacctctggtggattggaggatgatgttgat
gaaagtcttggcgaatcaggtccattcaaccacaagagatcgaggaggaaatcaaccttc
catggtcactcaaatggagatagtgaagatgaggatctgatacttcagatggagtcacgc
aagagaataaaagatataacacatagagataacaagggggttactactgataagacaagg
ggtgattcagcaacttcaggaaagctggttacagcaagaatgcagactgcatttcagcct
gggtctacaccacctcaacctggaaagcgaaatttccttgcctacaacatgcttggaagt
attactactattgaaaacgagggtcattcgcatgtagaggttgacttccatgacaccgga
agaggccctagagttccttcaatgaccgattattttggtttcacaatggctgcactgaat
gactcaggaagtgtcttcgctaatccatgcaagggtgacaagaatatgagcactcttatg
taccgtcctttcagtagctgggcgggtaacagtgagtggtcaatgaggtttgagggagaa
gaagtgaaggctgtggctgttggtaatggatgggttgctgcagttacaagtttaaatttc
ctacacattttcacagagggaggcttgcagatgcatatcctctcagtcaatggcccagtg
gttactgctgcaggacatggagatcagctagcgattgtgtctcatgcttcagattgtctt
tcctcgggagaccaggtgctggacgttaaagtgctgaagatatctgaatgtgctcaatca
ttgtccagccgacttgttttaagtccttcgtctcagttatcttggtttggtttcagtgag
aatggtgaacttagttcttttgattccaagggaatactgagggtcttttctggtcaattc
ggtggaagttggattccaatatttagttcaatcaaggcaagaaaatctgaagatgaaagc
cattgggtggtcggtttagatgccaataacatattctgcattctatgcaagtcccatgag
tattatccacaggtgacgcccaaacctgttttgacaatatttgagctttcatttcctgtt
gcgtcatctgaccttggtgccactagtttagaaaatgagtttgtgatgaggaagctacat
ctctcacagacccaaaagaaaatagaagaaatggctgctttgggtctggacacaactgcg
ttagatgatgaagcattcaacatggaagctgcacttgaccggtgcatcctgaggctcatt
tccagctgctgcaatggtgataagcttgttcgagctagtgaacttgctaaattattgaca
cttgagaagtcaatgaagggggctttgatgcttgttacacgtttgaagctgcccatatta
caagagaaattcagttccatacttgaggagaggatgctgaacgatgcaaaaattgtcaaa
acaacaggtgttttatccaatactaatacaaattacccaccatcactagcgttcagcact
caagcagttgcaccagctaaggttgtgcaaaatggaaacagtttgaagttatctacgttg
cctgaactgaatccggccacccaacaaaggaatccaagtgaatccaacaaggcagaggta
gaacatggaacccaatcgaaagaaagaagtctaaaggtttcacctttacaagctccgtta
gctaagatacaaaaaaacggtgaaaatgtggccataaaaacgaagaaagataaagatgga
tcatcacatgcaactacagttgatcagaacccaaagggaggcattcatcaggttgcccta
aaaaacatgagcaccgatgactgcagtggactacagcctcagcgaccagttaaccccttt
gctaaatcatcatcaagcaaagagcagccatcatctgtctttgattccatcaagaagatg
aaggttgaaaatgataaggttgacaaggctgacagcaagaaggtgaaagtgtaa

DBGET integrated database retrieval system