KEGG   Oryza brachyantha (malo sina): 102704156Help
Entry
102704156         CDS       T02995                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00010  Glycolysis / Gluconeogenesis
obr00053  Ascorbate and aldarate metabolism
obr00071  Fatty acid degradation
obr00280  Valine, leucine and isoleucine degradation
obr00310  Lysine degradation
obr00330  Arginine and proline metabolism
obr00340  Histidine metabolism
obr00380  Tryptophan metabolism
obr00410  beta-Alanine metabolism
obr00561  Glycerolipid metabolism
obr00620  Pyruvate metabolism
obr00903  Limonene and pinene degradation
obr01100  Metabolic pathways
obr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102704156
   00053 Ascorbate and aldarate metabolism
    102704156
   00620 Pyruvate metabolism
    102704156
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102704156
   00561 Glycerolipid metabolism
    102704156
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102704156
   00310 Lysine degradation
    102704156
   00330 Arginine and proline metabolism
    102704156
   00340 Histidine metabolism
    102704156
   00380 Tryptophan metabolism
    102704156
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102704156
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    102704156
Enzymes [BR:obr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102704156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102704156
NCBI-ProteinID: XP_006656871
UniProt: J3MD61
LinkDB All DBs
Position
6
AA seq 549 aa AA seqDB search
MPAATAARRALLSRCLLSSRPAPAAASSVPSALRRADGARGLLPAILQRFSTAAAAEEPI
SPPFQVQDKQLLIGGKFVDSASGKTFSTLDPRTGEVIAHVSEGDAEDINRAVSAARKAFD
EGPWPRMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYAQAANIEVPMVARLMRYY
AGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTVVLK
TAEQTPLSALYISKLLHEAGLPDGVINVVSGFGPTAGAALASHMDVDKIAFTGSTDTGKI
VLELAARSNLKSVTLELGGKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHE
RIYDEFVEKAKARAMKRVVGDPFKNGVEQGPQIDDDQFNKILRYIKYGVESGANLVTGGD
RLGDKGYYIQPTIFSDVKDNMKIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVF
TNNLNTANTLTRALRVGTVWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVV
TPLKNAAWL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccgctaccgctgcgaggagggctctcctctctcgctgcctgctgtcatccagg
cccgcgcccgccgccgcgtcatctgtcccctccgcgctccgcagggcagatggggcgcga
ggattgttgccggcaatccttcagaggttcagcactgcagcagctgcagaggagcccatt
tcacctccattccaagtgcaagacaaacagctcctcattggtggcaaattcgttgattca
gcatctggcaaaactttttcaactctggaccctcgtactggggaggtgattgcccatgtg
tctgaaggtgatgcggaggacattaaccgtgcagtttctgcggcccgcaaggcatttgat
gaagggccatggccaaggatgactgcctatgagagatcccggattctgttgcggtttgct
gatttgatagagaagcacaatgatgagctcgctgcattggagacatgggacaatggcaag
ccgtatgcgcaagctgccaacattgaagtgccaatggttgcccggctgatgcggtactat
gctggttgggctgacaagatccatgggctcgttgtgcctgctgatggcccgcaccatgta
caggtgctgcatgagcccattggtgttgcaggtcagatcatcccatggaactttccactt
ctgatgtttgcctggaaagttggccctgctttggcgtgtggaaatactgttgtgctcaag
acagctgagcaaactcctctgtctgctctatatatttctaagctgttgcatgaggctgga
ctcccggatggtgttattaatgtggtatctggatttggtcctactgctggtgctgctctt
gctagtcacatggatgtcgataagattgcattcactggatcgaccgataccggcaaaatt
gttcttgagttggctgcaaggagcaaccttaagtcagtgacactggagctaggaggcaag
tctccttttatcatcatggacgatgctgatgttgaccatgctgttgagcttgcgcatttt
gcactgttctttaaccagggacaatgttgctgtgctggatctcgcacatttgttcatgag
cgtatttatgatgagttcgtggagaaggccaaagctcgtgccatgaagcgtgtagttggt
gacccattcaagaatggtgttgaacagggcccccagatcgacgacgaccaattcaataag
atcttgcgctacattaagtatggtgttgaaagtggagccaaccttgttactggtggtgat
agattaggtgacaaagggtactacatccagccaacaattttctcagatgtcaaggataac
atgaagattgctcaagaagagatatttggacctgttcaatcaattctgaagttcaacgat
ctgaacgaggtgatcaagagggcaaatgcgagccagtatggactggcagctggagtcttc
accaacaacctgaacacggccaacaccctgacccgggctctcagggtcggaaccgtgtgg
gtgaactgcttcgacgtctttgacgccgcgatcccgttcggcgggtacaagcagagcggc
atcgggagggagaagggcatcgacagcctcaagaactacctgcaggtcaaggccgttgtc
acgccactcaagaacgccgcatggttgtaa

DBGET integrated database retrieval system