KEGG   Oryza brachyantha (malo sina): 102704350Help
Entry
102704350         CDS       T02995                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00020  Citrate cycle (TCA cycle)
obr00190  Oxidative phosphorylation
obr01100  Metabolic pathways
obr01110  Biosynthesis of secondary metabolites
obr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102704350
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102704350
Enzymes [BR:obr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102704350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 102704350
NCBI-ProteinID: XP_006658260
UniProt: J3MIF5
LinkDB All DBs
Position
7
AA seq 634 aa AA seqDB search
MWRGCVSRGLRSLSKGRATSSDPVSVSAAAAARLLSTTTSSSYTVVDHSYDAVVVGAGGA
GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
LGDQDSIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACA
ADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDSEGTCQGVIALNMEDGTLHRFRASN
TILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHL
PPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDS
VVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGDKQKPLEKSAGQ
KTIAWLDKLRNANGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLITKAWESYHDVK
ISDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEQWMKHSL
GYWENEKVRLAYRPVHMNTLDAEVESFPPKARVY
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcggctgcgtctcgcgtggcctcaggagcctctccaagggcagggccacctcc
tccgaccccgtctccgtctccgccgccgccgccgctaggctcctctccaccacgacctcg
tcgtcgtacacggtggtggatcactcgtatgacgcggtcgtggtgggggccggcggcgcg
gggctccgcgcggcgatcgggctctccgagcacggcttcaacaccgcttgcatcaccaag
ctcttccccacgcggtcgcacaccgtcgcggcgcagggtggcataaatgctgctcttgga
aacatgacggaagatgactggaggtggcatatgtatgacactgtcaaggggagtgattgg
cttggtgaccaggattctattcaatatatgtgcagagaagcaccaaaagcagttatagaa
cttgaaaactatggcttgccattttcaagaactgaagatgggaagatataccagcgtgcc
tttggaggccagagcttagattttgggaaaggtggacaggcgtaccgatgtgcatgtgct
gctgacagaacaggacatgctatgctacacacactatatggtcaagcaatgaagcataat
actcagtttttcgtagaatattttgcactagaccttattatggacagtgaaggcacctgt
cagggggtcattgctttgaacatggaggatggcacccttcaccgtttccgtgcttcaaat
acaattctggccacaggaggttatggcagagcctacttctcagcaacctcagctcacaca
tgcactggagatggcaacgctatggttgcacgtgctggtttaccacttcaggaccttgag
tttgtgcagttccatcctacaggcatttatggggctggatgcctcatcactgaaggttcc
cgtggtgaaggtggtatccttaggaatagtgaaggcgagcgtttcatggaacgatatgct
cctactgcaaaagatcttgcttctcgagatgttgtttcaagatctatgacaatggaaatc
agagaaggccgtggtgttgggccattgaaggaccacatctatttgcaccttaaccatctg
cctcctgaagttcttaaggagaggcttcctggtatttctgaaactgctgctatttttgct
ggtgttgatgtcaccaaggagcccattcctgtcctgcctactgtgcactacaatatgggt
gggatcccaacaaattaccatggagaggtggtgactatcaagggtgacaatcctgattct
gttgttcctggtctgatggctgcgggagaagcggcatgtgcatccgttcatggtgcaaac
cgtctgggtgcaaattcacttcttgacatagttgtgtttggcagagcttgtgcaaacagg
gttgctgaaatttctaaaccaggtgacaagcagaaacctcttgaaaaaagtgctggacaa
aagaccatagcctggttagacaagctgagaaatgcaaatggatcattgccaacctccaag
atccgtctaaacatgcaacgtgttatgcaaaacaatgctgctgtcttccgtacacaagaa
acactcgaagaaggttgtcaattgattaccaaagcatgggaaagctatcatgacgtgaag
atcagtgatcggagtctcatatggaattcagatttgatagaaaccattgagttggaaaat
ctcttgataaatgcgtgcataaccatgcattcagcggaggctcggaaggaaagcagagga
gctcatgctcgtgaagatttcacgaaaagagatgatgagcagtggatgaagcactcgttg
gggtactgggagaatgagaaggttcggttggcatacaggccagtccacatgaacacattg
gatgctgaagtcgagtcattcccaccgaaggcccgtgtttattag

DBGET integrated database retrieval system