KEGG   Oryza brachyantha (malo sina): 102706390Help
Entry
102706390         CDS       T02995                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZ1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102706390
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:obr03036]
    102706390
Enzymes [BR:obr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102706390
Chromosome and associated proteins [BR:obr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102706390
   Polycomb group proteins
    PRC2-EZH2 complex
     102706390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR SLIDE
Motif
Other DBs
NCBI-GeneID: 102706390
NCBI-ProteinID: XP_015694091
UniProt: D4N3V9
LinkDB All DBs
Position
6
AA seq 893 aa AA seqDB search
MAGDSRNEPMQSEEGSNESSYVLCVIDALKKKITSDRFLYIKKRIEDNSIKLSPIIQHSH
SLSKNRQTSTSNSTDLVLNLLTKRQEDALCAVNSRESSPDEDEGGNSQDECSSTVIVGGN
LSTKNAIRPIRLPEVSTLPPYTTWIFLDRNQRMQEDQSVLGRRRIYYDTNCGEALICSDS
EDEAVDDEEEKKEFKDSEDRIIRMTIQECGMSDAVLETLARDIERAPDDIKARYEILEGE
KPEGSFKKVSELNVKMEDMYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEK
QLPLCSSDDGTPCGIHCYKVASKPDVVMMMLVDIEEPTHSPENARNQIGSNKKKLGSSGQ
KAKSQQSESSSTARVSSESSESEVQLLSNKSPQHSPGLSKNKIGTKGGIKKSTNRRIAER
ILMSVKKGQQEMAADSNSIINGCLWPRDMKLRSDTRSGIKDSITSSQYTSPSTRSSRKKG
VLQMENSSSFVDAQSDSMEDTNNEHSATDGDSSRIEEFVDENVRSQEAHARSWKLIEQGL
LLKGLEIFGRNSCLIARNLLGGMKTCTDVFQYMNYIENSSASGALSGVDSLVKGYIKGNE
SRTRSRFVRRRGRVRRLKYTWKTAGYHFIRKRITERKDQPCRQYTPCGCQSACGKQCPCL
TNGTCCEKYCGCPKMCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWVGCGDGT
LGVPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGELISH
KEADKRGKIYDRENSSFLFNLNNEYVLDAYRMGDKLKFANHSPDPNCYAKVIMVAGDHRV
GIFAKERISAGEELFYDYRYEPDRAPAWARKPEAAGAKDDAQPSTGRAKKLAH
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgattcccgaaatgagccgatgcaatccgaggaagggagtaacgaatcgagc
tatgttctctgtgttattgatgcattgaagaagaaaatcacatcagaccgctttctttac
atcaagaaaaggatagaggataatagcattaagctcagcccaattatacagcactctcac
agtttgtcgaaaaataggcaaactagtacatccaacagtacagatttagttttgaatttg
ctcacaaagaggcaagaagatgccctgtgtgctgtaaatagtcgtgagtcatctcctgat
gaagatgaaggcggcaattctcaagatgagtgttcatcgaccgttattgtgggtgggaac
ctatccacaaagaatgctatccgtccgattagattaccagaagtgtcaacactccctcca
tatacaacttggatatttctggacaggaaccagcggatgcaagaagaccaatctgtactt
ggtcgtcgaaggatttactatgatacaaactgtggcgaagctttaatttgcagtgacagt
gaagatgaagctgttgatgacgaggaagagaaaaaggagttcaaggattccgaagatcgc
ataattcggatgaccattcaagaatgtggcatgtctgatgctgtgcttgaaactctagct
cgagatatcgaaagggctcctgatgatataaaggccaggtatgagatcctagaaggggag
aaacctgagggttctttcaagaaagtgtctgaacttaatgtcaaaatggaagacatgtat
ggtgataaagatctggatgcagcattggattcctttgacaatctcttttgtcgccgatgt
ttagtttttgattgcaagctacatgggtgttcgcaagatttagtgtttccgacagaaaag
cagctaccattgtgcagctcggatgatggtacaccatgtggtattcactgttacaaagtg
gcctctaagccagatgttgtcatgatgatgcttgttgatatcgaggagccaactcactca
ccagagaatgcaaggaaccagatagggtcaaataaaaaaaagcttggttctagtggacag
aaagcaaaatctcaacaaagtgaaagttcttcaactgcaagggtttcctcagaaagcagc
gagtctgaagtacaattgttaagcaataaatccccgcaacactctcctggcctctcaaaa
aataagattggcacaaaaggtggaatcaagaaaagtactaacagaagaattgctgagaga
attctaatgagtgtgaaaaagggacaacaggaaatggcagcagactcaaattctattatt
aatggatgcctttggcctagggatatgaagcttagatctgatactaggagtggaattaag
gattccattacatcctcgcaatatacttctccaagcacaagaagttctagaaagaagggt
gtgcttcaaatggagaatagctcatcttttgtggatgctcagagtgattcaatggaggat
acaaataatgaacattcagcaacagatggtgatagttcaaggatagaggaatttgttgat
gagaacgtacgtagccaagaagctcatgccaggtcctggaagctgattgagcaagggctt
ctattgaaaggattagagatttttggaaggaacagttgtttaattgctcggaaccttctg
ggtgggatgaaaacatgcacagatgtttttcagtatatgaattacattgaaaacagcagt
gcatctggagctcttagtggtgttgattctcttgttaaaggatatataaagggtaatgaa
tcacgcacacgatcaagatttgtcagaaggcgaggacgagtccgccgtttaaagtacacc
tggaaaactgcaggctaccattttattaggaaaaggattacagaaaggaaggatcaacct
tgtcgacaatacactccttgtggttgtcagtctgcatgcgggaagcaatgtccgtgtctc
acaaatggtacctgctgtgagaaatactgtgggtgccccaaaatgtgcaagaatcgcttc
cgaggttgccattgtgctaagagtcagtgtcgcagccgtcagtgtccatgctttgctgct
gacagggaatgtgatcctgacgtgtgtagaaactgctgggtagggtgcggtgatggtaca
ttgggggttcccaaccaaagaggtgataattatgaatgccggaacatgaaactgctgctt
aaacagcaacaaagggtcttacttgggagatctgatgtttctggctggggagctttcctg
aagaatagtgttggcaagcatgagtatcttggcgagtacactggggagcttatctcccat
aaggaagctgacaagcgtggaaagatctatgaccgtgagaattcgtcgttccttttcaac
ttgaataatgagtacgttcttgacgcgtacagaatgggcgacaagctgaagtttgccaac
cattccccggacccaaactgctacgccaaggtcatcatggtagcaggcgaccacagggtg
ggcatcttcgccaaagagcggatcagcgccggcgaggagctgttctacgactatcgctac
gagcccgaccgggccccggcatgggctcgcaagcccgaggcggccggtgccaaggacgac
gcccagccttctactgggagagcaaagaagctcgctcactga

DBGET integrated database retrieval system