KEGG   Oryza brachyantha (malo sina): 102707421Help
Entry
102707421         CDS       T02995                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00250  Alanine, aspartate and glutamate metabolism
obr00410  beta-Alanine metabolism
obr00430  Taurine and hypotaurine metabolism
obr00650  Butanoate metabolism
obr01100  Metabolic pathways
obr01110  Biosynthesis of secondary metabolites
Module
obr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102707421
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102707421
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102707421
   00430 Taurine and hypotaurine metabolism
    102707421
Enzymes [BR:obr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102707421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 102707421
NCBI-ProteinID: XP_006659485
UniProt: J3MTN5
LinkDB All DBs
Position
8
AA seq 500 aa AA seqDB search
MVLSRASSSPDDPDAAVRCTFASRYACESLPRFRMPERSTPREAAYQIINDELMLDGNPR
LNLASFVTTWMEPECDKLIMGSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIKEDET
AIGVGTVGSSEAIMLAGLAFKRKWQNKRKEQGKPCDKPNIVTGANVQVCWEKFARYFEVE
LKEVKLSEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNNLLTEKNKETGW
DVPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYPGVGWVIWRRKEDLP
EELIFHINYLGTDQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMQNCMENTAVLRAG
IEATGRFDILSKEAGVPLVAFSLKDSGRYTVFDISENLRRFGWIVPAYTMPADAEHVAVL
RVVVREDFSRSLAERLVSDVVKILHELDAHAAQVVKVSSAVAKQSVSGDGGVVTKKSVLE
TEREIFTYWRDQVRKKTGVC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcgcgcgcgagctccagcccggacgaccccgacgccgccgtgcgctgcacc
ttcgcgtcgcgctacgcctgcgagagcctgccgcggttccggatgccggagcggtcgacg
ccgagggaggcggcgtaccagatcatcaacgacgagctgatgctggacggcaacccgcgg
ctgaacctggcgtcgttcgtcaccacatggatggagcccgagtgcgacaagctcatcatg
ggctccatcaacaagaactacgtcgacatggacgagtaccctgtcaccacggagcttcag
aaccgttgtgtgaatatgatagctcacctgttcaatgcaccaattaaggaggatgaaaca
gctattggagttgggacagtgggatcctccgaagcaattatgcttgcaggactggccttc
aagaggaagtggcaaaacaagcggaaggagcaagggaagccatgtgacaaacccaacatt
gttactggcgctaatgttcaggtttgctgggagaaatttgctagatattttgaagtagaa
ctgaaggaggttaagcttagtgaaggatactatgtcatggatcctgtaaaagctgttgaa
atggtggatgagaacacgatatgcgttgcggccatcttgggctctactctcactggagag
tttgaagatgttaagttgctgaataatcttctgacggaaaagaacaaggaaactgggtgg
gatgtgccaattcatgttgatgcagcaagtggaggatttatagcaccttttctgtaccca
gagcttgaatgggacttcaggctgccactggtgaagagcatcaatgtcagtggacataag
tatggccttgtgtatccaggtgttggttgggtcatttggcggcgcaaagaggatttgcct
gaagaactcattttccatataaactatctggggacagaccagcctacattcactctgaac
ttctccaaaggttccagccagataatagcacagtactatcaactgatacgtttgggattc
gagggatacaagaacatcatgcagaactgcatggagaacacggcagtactaagggcaggc
atagaggcgactggtcgattcgacatcctctccaaggaggccggcgtgcccctggtggcg
ttctcgctcaaggacagcggcaggtacaccgtgttcgacatctccgagaacctgcggagg
ttcggctggatcgtgccggcctacaccatgccggccgacgccgagcacgtggccgtcctc
cgcgtcgtcgtcagggaggacttcagccggagcctcgccgagcggctcgtctcggacgtc
gtcaagatcctgcacgagctggacgcccacgcggcgcaggtcgtgaaggtctccagcgcc
gtcgcgaagcagtcggtgtcgggcgacggcggtgtggtgaccaagaagagcgtgctggag
accgagagggagatcttcacctactggagggaccaggtgaggaagaagactggagtctgc
tag

DBGET integrated database retrieval system