KEGG   Oryza brachyantha (malo sina): 102707738Help
Entry
102707738         CDS       T02995                                 

Definition
(RefSeq) hexokinase-6
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00010  Glycolysis / Gluconeogenesis
obr00051  Fructose and mannose metabolism
obr00052  Galactose metabolism
obr00500  Starch and sucrose metabolism
obr00520  Amino sugar and nucleotide sugar metabolism
obr01100  Metabolic pathways
obr01110  Biosynthesis of secondary metabolites
obr01200  Carbon metabolism
Module
obr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
obr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102707738
   00051 Fructose and mannose metabolism
    102707738
   00052 Galactose metabolism
    102707738
   00500 Starch and sucrose metabolism
    102707738
   00520 Amino sugar and nucleotide sugar metabolism
    102707738
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102707738
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:obr04131]
    102707738
Enzymes [BR:obr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102707738
Membrane trafficking [BR:obr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102707738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FxsA DUF3824
Motif
Other DBs
NCBI-GeneID: 102707738
NCBI-ProteinID: XP_015699141
LinkDB All DBs
Position
1
AA seq 506 aa AA seqDB search
MGKGAVGGTAVVVCAAAAAAVGVAVVVSRRRRSMREAEAERRRKAAAVIEEVEQRFSTPT
ALLRGIADAMVEEMERGLRADPHAPLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVIRV
QLGGREKRVVSQQYEEVAIPPHLMVGTSMELFDFIAAELESFVKTEGEDFHLPEGRQREL
GFTFSFPVHQTSISSGTLIKWTKGFSINGTVGEDVVAELSRAMERQGLDMKVTALVNDTV
GTLAGGRYVDNDVVAAVILGTGTNAAYVEHANAIPKWTGLLPRSGDMVINMEWGNFKSET
LPRSEYDSVLDFESLNPGEQIYEKMISGMYLGEIVRRILLKLAHDASLFGDVVPPKLEQR
FVLRTPDMSAMHHDTSHDLKHLGAKLKDILGVADTSLEARYITLHVCDLVAERGAHLAAA
GIYGILKKLGRDSVPSDGSQKQRTVIALDGGLYEHYKKFRTCLEATLTDLLGDDAASSVV
VKLANDGSGIGAALLAASHSQYASVE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggggaagggggcggtcggggggacggcggtggtggtgtgcgccgcggccgccgcagcg
gtcggggtggccgttgtggtgtcgcggaggaggaggagcatgcgggaggcggaggcggag
aggcggaggaaggccgccgcggtgatcgaggaggtggagcagaggttctccacgcccacg
gcgctgctgcgcggcatcgcggacgccatggtggaggagatggagcgcgggctccgcgcc
gacccccacgccccgctcaagatgctcatcagctacgtcgacaacctccccaccggggat
gaacatggactgttctatgctctagatcttgggggcaccaatttccgtgtcatacgggtt
cagcttggaggaagggaaaaacgtgttgtctctcaacagtatgaagaggttgcgattcca
cctcacctgatggttgggacttctatggaactgtttgatttcattgcggctgaattggaa
agttttgtcaagactgaaggagaggatttccacttgccagagggcaggcagagagagctg
ggcttcaccttttctttcccagtgcaccaaacatcaatatcgtcaggcactcttattaag
tggacaaagggattttccatcaacggcacggtgggagaagatgttgtagctgaattgagc
agggctatggaaagacaagggcttgatatgaaagttacagctcttgttaatgacactgta
ggcactttggctggcggaagatatgttgataatgatgtagttgctgctgtaatattaggc
actggtacaaatgcagcatacgtggagcatgcgaatgcgattccaaaatggactggacta
ctaccaagatcaggagatatggtgattaacatggaatggggaaacttcaagtcagaaacg
cttcctcgttcagaatatgatagtgtcttggactttgaaagtttgaaccccggcgagcag
atatatgaaaagatgatttctggcatgtatcttggagagattgtgcgcagaatcctgctt
aagctggctcatgacgcttcattatttggggatgttgttccaccaaaactggagcagcgc
tttgtactgaggacgccggacatgtcagcgatgcatcatgatacctcacatgatctgaaa
cacctgggagctaagctgaaggatatcctgggggtcgctgatacttccctggaagcacga
tacatcactcttcatgtctgcgaccttgtcgcagagagaggtgcacatttagctgctgct
ggcatatatggcattctaaagaagttaggcagggacagtgtgccaagtgacggtagtcaa
aagcagaggactgtcattgctctggatggtggtctctatgagcattacaagaagttcaga
acctgcctagaagcaacgcttacagacctgctcggagacgacgctgcctcatcagttgtt
gtcaagttggcaaatgatggctctggcatcggagccgcacttcttgcagcatctcactcc
cagtatgctagcgtcgaatag

DBGET integrated database retrieval system