KEGG   Oryza brachyantha (malo sina): 102709187Help
Entry
102709187         CDS       T02995                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00052  Galactose metabolism
obr00500  Starch and sucrose metabolism
obr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102709187
   00500 Starch and sucrose metabolism
    102709187
Enzymes [BR:obr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102709187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Adeno_E4_ORF3
Motif
Other DBs
NCBI-GeneID: 102709187
NCBI-ProteinID: XP_015693719
LinkDB All DBs
Position
6
AA seq 862 aa AA seqDB search
MATRAPPLLLSLCLCFVSCFSSRWSDELAASGNGYYRTTAFLVDGEGRRLRAELAACGGG
PTAYGDDVPRVDVYASLETDTRLHVRITDADHRRWEVPQDVIPRPTPESFLDAPRPGARV
LSTATSDLTFALHASPFRFTVSRRSTGDVLFDTSPSLVFKDRYLELTSSLPADRASLYGL
GEHTKQTFRLQRNDTFTLWNSDIAAGNVDLNLYGSHPFYMDVRSNGAGAAHGVLLLNSNG
MDVIYGGSYVTYKVIGGVLDFYFFAGPSPLAVVDQYTQLIGRPAPMPYWSFGFHQCRYGY
KNVADLEGVIAGYAKARIPLDVMWTDIDYMDAFKDFTLDPVNFPADQLRPFVDRLHRNGQ
KYVVIIDPGINVNTTYGTFVRAMKQDIFIKWNGSNYLGVVWPGNVYFPDFLNPRTAEFWA
QEIATFRRTIPVDGLWIDMNEVSNFVDPPMLNALDDPPYRINNSGVRRPISNKTVPASAV
HYGGVSEYDAHNLYGFLEARATHTALLRDTGRRPFVLSRSTFVGSGRYTAHWTGDNAATW
DDLRYSINSILNTGLFGIPMVGADICGFGGNTTEELRWIQLGAFYPFSRDHSALGTVRRE
LYLWESVARSARKALGLRYRLLPYIYTLMYEAHVTGAPIARPLFFSYPGDVETYGIDRQF
LLGRGVLVSRRWFSLYDYSLTVSTKTGKRVTLPAPADTVNVHVAGGNILPLQQPALTSSR
VRQSVFHLLLALADDGTASGDLFLDDGESPEMVGARSKWSHVKFSGAAENGGVVRVRSHV
VHDSYAPSRTLVIGMVVLTGLQSPAPPKGFAVHVNGVQVNASTTAGSAAAGNHKNGALGT
VHVGGLALAVGQEFDLKVVMNY
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagagctccgccattgttgctgtccctgtgtctctgcttcgtttcttgcttc
agctcccggtggtccgatgagcttgcagcttccggcaatggctactaccggaccacggcg
tttctggtggacggggaagggaggcggctccgtgccgagctcgctgcctgcggaggcggg
ccgacggcgtacggcgacgacgtgccaagggtggacgtgtatgccagcttggagacggac
acccggctgcacgtccgcatcaccgacgccgaccaccggcgatgggaggtgccccaggac
gtcatcccgcgccccacgccggagtccttcctcgacgcgccgcgcccgggcgcccgcgtc
ctctccaccgccacctccgacctcaccttcgccctccacgcctccccgttccgcttcacc
gtctcccgccgctccaccggcgacgtcctcttcgacacctccccaagcctcgtcttcaag
gaccggtacctcgagctgacgtcgtcgctgccggccgaccgggcgtcgctctacggcctc
ggcgagcacaccaagcagacgttccggctgcagcgcaacgacaccttcacgctctggaac
tccgacatcgccgccggcaatgtcgacctcaacctctacggctcccacccgttctacatg
gacgtgcggtccaacggcgccggcgctgcgcacggcgtgctcctcctcaacagcaacggg
atggacgtcatctacggcgggtcctacgtcacctacaaggtgatcggcggcgtgcttgac
ttctacttcttcgccggcccgtcccctctcgccgtcgtcgaccagtacacgcagctcatc
ggccgtcccgctcccatgccctactggtcattcgggttccaccagtgcaggtatgggtac
aagaacgtggctgatcttgaaggcgtcatcgccggctacgccaaggcgaggatcccactt
gacgtgatgtggacggacatcgactacatggacgccttcaaggacttcacgctggatccg
gtgaacttcccggccgaccaactccggccgttcgtcgaccgcctccaccgcaacggccag
aagtacgtcgtcatcattgacccagggatcaacgtgaacacgacgtacggcacgttcgtc
cgagcgatgaagcaggacatcttcatcaagtggaacggcagcaactacctcggcgtggtg
tggccggggaacgtctacttcccggacttcctcaacccgcgcaccgccgagttctgggcg
caggagatcgccacgttccggcggaccatccccgtcgacgggctgtggatcgacatgaac
gaggtctccaacttcgtcgacccgccgatgctcaacgcgctcgacgacccgccctaccgc
atcaacaactccggcgtgcgccgccccatcagcaacaagacggtgccggcctccgccgtg
cactacggcggcgtgtctgagtacgacgcgcacaacctctacggcttcctcgaggcgcgc
gccacgcacaccgcgctgctccgggacactggccgccggccgttcgtgctgagccgctcc
acgttcgtcggctccggcaggtacaccgcacactggactggcgacaacgccgcgacgtgg
gacgacctccgttactccatcaacagcatactcaacaccggcctcttcggcatccccatg
gtcggcgccgacatctgcggcttcggcggcaacaccaccgaggagctccgctggattcag
cttggcgctttctacccgttctcgagggatcactcggcgctcggcaccgtccggcgagag
ctgtacctgtgggagtcggtggcgcggtctgcgaggaaggcgctcgggctgcgctaccgg
ctgctcccctacatctacacgctcatgtacgaggcgcacgtcacgggcgcgcccatcgcg
cggccgctcttcttctcctaccccggcgacgtcgagacgtacggcatcgacaggcagttc
ctgctcggccgcggcgtgctcgtgtcacgccggtggttcagcctctacgactactccctc
accgtctccaccaaaaccggcaagcgcgtgacgctccccgctccggcggacacggtgaac
gtgcacgtcgccggcggcaacatcctgccgctgcagcaacccgcgctgacgtcgtcgcgc
gtgcgccagagcgtgttccacctcctgctcgcgctcgccgacgacggcacggccagcggg
gacctcttcttggacgacggagagtcaccggagatggtcggcgcgcggagcaagtggagc
cacgtcaagttcagcggcgcggccgagaacggcggcgtggtcagagtcaggtcgcacgtg
gtgcacgactcctacgcgccgagccggacgctggtcatcggcatggtggtgctcacgggc
ctgcagtcgccggcgccgcccaaagggttcgccgttcatgtcaacggcgtccaggtgaac
gcgagcacgacggccggcagcgccgccgccgggaaccacaagaacggagcgctgggcacc
gtgcacgtcggcgggctggcgctggccgtcggacaggagttcgatctgaaggtcgtgatg
aactattaa

DBGET integrated database retrieval system