KEGG   Oryza brachyantha (malo sina): 102711553Help
Entry
102711553         CDS       T02995                                 

Definition
(RefSeq) histone deacetylase 6-like
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
obr  Oryza brachyantha (malo sina)
Brite
Enzymes [BR:obr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102711553
Chromosome and associated proteins [BR:obr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102711553
   HDAC complexes
    Sin3A-HDAC complex
     102711553
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102711553
  Chromatin remodeling factors
   NuRD complex
    102711553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102711553
NCBI-ProteinID: XP_006659341
UniProt: J3MSC3
LinkDB All DBs
Position
8
AA seq 458 aa AA seqDB search
MAASGEGASLPSQGGGEDARRRRVSYFYEPSIGDYYYGQGHPMKPHRIRMAHSLVVHYGL
HRLLELSRPYPASEADIRRFHSDDYVAFLASATGNPALLDARAVKRFNVGEDCPVFDGLF
PFCQASAGGSIGAAVKLNRGDADITVNWAGGLHHAKKGEASGFCYVNDIVLAILELLKFH
RRVLYVDIDVHHGDGVEEAFFTTNRVMTCSFHKYGDFFPGTGHISDIGIGEGKHYALNVP
LSDGIDDDTFRDLFQCIIKKVMEVYQPDVVVLQCGADSLAGDRLGCFNLSVKGHADCLRY
LRSFNIPMMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNDYYEYFGPDYNLHIQP
RSVENLNTTKELENMKTMILEHLSQIEHVPSTQFHDRPSDPEAPQEEEEDMDKRPPQRSR
LWSGGAYESDTEDPDNMKTETNDLSASSVMKDESNGDS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccggcgagggcgcgtcgctgccgtcgcagggcggcggggaggacgcccgg
cggcggcgggtgagctacttctacgagccgtcgatcggcgactactactacgggcagggg
cacccgatgaagccccaccgcatccgcatggcgcactcgctggtcgtccactacggcctc
caccgcctcctcgagctctcccgcccctacccggcctccgaggccgacatccgccgcttc
cactccgacgactacgtcgccttcctcgcctccgccaccggcaacccggccctcctcgac
gcccgcgccgtcaagcgcttcaacgtcggcgaggactgccccgtcttcgacggcctcttc
cccttctgccaggcctccgcggggggcagcatcggcgccgccgtcaagctcaaccgcggg
gacgccgacatcaccgtcaactgggcggggggcctccaccacgccaagaagggcgaggcc
tccgggttctgctacgtcaacgacatcgtcctcgccatcctcgagctcctcaagttccac
aggcgtgtgctatatgtagacattgatgtccaccatggagatggtgtggaggaagctttc
ttcactacaaatcgagtcatgacttgttcttttcacaagtacggggattttttccctggt
actggacatatcagtgatattggaataggcgaagggaaacattatgctttaaatgtgccc
ctgagtgatggtattgatgatgacacctttcgtgatctgttccagtgcatcattaaaaag
gtaatggaggtttatcagccagacgttgttgtactccagtgtggagcagactctttggct
ggagacaggttaggttgcttcaacctgtctgtgaaaggtcatgcagactgcctccgttac
cttaggtctttcaatattcctatgatggttttaggaggtgggggttacaccatcagaaat
gttgctcgctgctggtgctatgagactgcagttgctgttggagttgaacctgataacaag
ttaccttataatgactactatgagtactttggtcctgattataatcttcatattcaacca
agaagtgtggagaacctgaatacaactaaagagttggagaacatgaagaccatgatattg
gaacatctctcacaaatagagcatgttccaagcactcagtttcatgacagaccatcagac
cctgaagctccacaggaggaagaggaggacatggacaagagaccacctcagcgcagtaga
ttatggagtggaggagcttatgagtctgatacagaggatcctgacaacatgaaaactgag
acgaatgacttatctgccagctctgtcatgaaggatgaatcaaatggtgattcctag

DBGET integrated database retrieval system