KEGG   Oryza brachyantha (malo sina): 102712703Help
Entry
102712703         CDS       T02995                                 

Definition
(RefSeq) thymidine kinase-like
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00240  Pyrimidine metabolism
obr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102712703
Enzymes [BR:obr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     102712703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 AAA_30 AAA_24 cobW
Motif
Other DBs
NCBI-GeneID: 102712703
NCBI-ProteinID: XP_006649678
UniProt: J3LLM7
LinkDB All DBs
Position
3
AA seq 274 aa AA seqDB search
MRSICAMRSLLAASTFLRSTASSLRPASRTLPSRLSLSRPRLGAARPVSAAAAESRGGGG
SDSGMDDHLVRSGEIHVIVGPMFAGKTTALLRRVQVEAGNGRNVALIKSDKDNRYGLDSV
VTHDGTKMACWALPELSSFQDKLGAEAYDKVDVIGIDEAQFFDDLHDFCCKAADRDGKIV
VVAGLDGDYKRNKFGSVLDIIPLADSVTKLTARCELCGRRAFFTLRKTRETKTELIGGAD
VYMPVCRQHYLDGQIVIEATRIVLERSTVIHAMK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccatttgcgcaatgagatccctcctcgccgcctccaccttcctacgctccacc
gcttcctctctgcggcccgcttcacgtacgctcccttcccggctgagcctctcccgccct
aggctcggcgcggcgaggccggtctctgcggcagcggccgagtctcgaggcggcggcggc
agtgactctggaatggatgaccatttggtgcgttccggcgagattcacgtcatcgtgggc
cccatgttcgccgggaagaccacggcccttctccggcgcgtgcaggtcgaggctggcaat
ggcaggaacgtggcactcatcaagtctgacaaggacaataggtatggattggattctgtc
gtaacacatgatggcacaaagatggcatgctgggctttacctgagctttcaagttttcaa
gataaattaggagcagaggcttatgataaggttgatgtcataggtattgacgaagcacag
ttctttgatgatcttcatgatttctgctgcaaagctgctgaccgtgatggaaaaattgtt
gtagtcgcagggctagatggcgactacaaaaggaacaagtttggctcagttctggacatt
atacccttggctgactcagtcaccaagcttaccgcgcgctgtgagttatgtggtcgccgt
gcattcttcacgttgaggaagacacgggaaactaagactgagctcattggaggagctgat
gtatacatgcctgtatgtaggcaacactacctggatgggcagattgtcattgaggccaca
aggattgttcttgaaagatccacagtgatccatgctatgaaatga

DBGET integrated database retrieval system